Difference between revisions of "checkupdates 1527418483"

From F-Droid
Jump to: navigation, search
(Run log)
(No difference)

Latest revision as of 17:23, 27 May 2018

  • command line: /home/fbuild/fdroidserver/fdroid checkupdates --auto --commit --quiet
  • fdroiddata: f4d7780d96bf87a7b9c66f27bf44fefddc7ae79a
  • started at 2018-05-27 10:54:43Z
  • completed at 2018-05-27 17:34:47Z

Installed Android Tools

local source check

  • Processing An.stop
  • Processing SpeedoMeterApp.main
  • Processing a2dp.Vol
  • Processing aarddict.android
  • Processing acr.browser.barebones
  • Processing acr.browser.lightning
  • Processing akk.astro.droid.moonphase
  • Processing am.ed.exportcontacts
  • Processing am.ed.importcontacts
  • Processing am.zoom.mbrowser
  • Processing am.zoom.mlauncher
  • Processing andraus.bluetoothhidemu
  • Processing androdns.android.leetdreams.ch.androdns
  • Processing android.androidVNC
  • Processing android.game.prboom
  • Processing android.tether
  • Processing anupam.acrylic
  • Processing app.android.com.materialfilemanager
  • Processing app.easytoken
  • Processing app.librenews.io.librenews
  • Processing app.openconnect
  • Processing app.varlorg.unote
  • Processing apps.babycaretimer
  • Processing apps.droidnotify
  • Processing aq.com.sharetobrowser
  • Processing ar.com.tristeslostrestigres.diasporanativewebapp
  • Processing ar.com.tristeslostrestigres.redpanal
  • Processing ar.rulosoft.mimanganu
  • Processing arity.calculator
  • Processing at.bitfire.cadroid
  • Processing at.bitfire.davdroid.mirakel
  • Processing at.bitfire.davdroid
  • Processing at.bitfire.gfxtablet
  • Processing at.bitfire.icsdroid
  • Processing at.bitfire.nophonespam
  • Processing at.dasz.KolabDroid
  • Processing at.fhhgb.mc.swip
  • Processing at.huber.sampleDownload
  • Processing at.linuxtage.companion
  • Processing at.maui.cheapcast
  • Processing at.tomtasche.reader
  • Processing at.univie.sensorium
  • Processing at.zweng.bankomatinfos
  • Processing at.zweng.bankomatinfos2
  • Processing atitel.com.todoer
  • Processing atm.nasaimages
  • Processing atm.rocketguardian
  • Processing atm.starun.game
  • Processing au.com.darkside.XServer
  • Processing au.com.wallaceit.reddinator
  • Processing au.id.micolous.farebot
  • Processing aws.apps.androidDrawables
  • Processing aws.apps.usbDeviceEnumerator
  • Processing axp.tool.apkextractor
  • Processing bander.notepad
  • Processing be.ac.ulb.lisa.idot.android.dicomviewer
  • Processing be.brunoparmentier.apkshare
  • Processing be.brunoparmentier.dnssetter
  • Processing be.brunoparmentier.openbikesharing.app
  • Processing be.brunoparmentier.wifikeyshare
  • Processing be.digitalia.fosdem
  • Processing be.geecko.QuickLyric
  • Processing be.lionslink.ucllstudent
  • Processing be.mygod.vpnhotspot
  • Processing be.norio.randomapp
  • Processing be.ppareit.shutdown
  • Processing be.ppareit.swiftp_free
  • Processing be.quentinloos.manille
  • Processing be.uhasselt.privacypolice
  • Processing biz.codefuture.svgviewer
  • Processing biz.gyrus.yaab
  • Processing br.com.dgimenes.nasapic
  • Processing br.com.frs.foodrestrictions
  • Processing br.odb.knights
  • Processing br.usp.ime.retrobreaker
  • Processing btools.routingapp
  • Processing budo.budoist
  • Processing buet.rafi.dictionary
  • Processing bughunter2.smsfilter
  • Processing bus.chio.wishmaster
  • Processing byrne.utilities.converter
  • Processing byrne.utilities.hashpass
  • Processing byrne.utilities.pasteedroid
  • Processing ca.cmetcalfe.locationshare
  • Processing ca.cmetcalfe.xposed.disablebatterywarnings
  • Processing ca.cmetcalfe.xposed.flatconnectivityicons
  • Processing ca.cumulonimbus.barometernetwork
  • Processing ca.ddaly.android.heart
  • Processing ca.farrelltonsolar.classic
  • Processing ca.mimic.apphangar
  • Processing ca.mudar.fairphone.peaceofmind
  • Processing ca.pr0ps.xposed.entrustunblocker
  • Processing ca.rmen.android.frenchcalendar
  • Processing ca.rmen.android.networkmonitor
  • Processing ca.rmen.android.poetassistant
  • Processing ca.rmen.android.scrumchatter
  • Processing ca.rmen.nounours
  • Processing cacafogo.software.touchBalance
  • Processing caldwell.ben.bites
  • Processing caldwell.ben.trolly
  • Processing campyre.android
  • Processing cat.jordihernandez.cinecat
  • Processing cat.mvmike.minimalcalendarwidget
  • Processing cat.pantsu.nyaapantsu
  • Processing cc.co.eurdev.urecorder
  • Processing cc.rainwave.android
  • Processing cgeo.geocaching
  • Processing ch.abertschi.adfree
  • Processing ch.bailu.aat
  • Processing ch.blinkenlights.android.apnswitch
  • Processing ch.blinkenlights.android.vanilla
  • Processing ch.blinkenlights.android.vanillaplug
  • Processing ch.blinkenlights.battery
  • Processing ch.citux.td
  • Processing ch.corten.aha.worldclock
  • Processing ch.deletescape.lawnchair.plah
  • Processing ch.dissem.android.drupal
  • Processing ch.fixme.cowsay
  • Processing ch.fixme.status
  • Processing ch.hgdev.toposuite
  • Processing ch.hsr.eyecam
  • Processing ch.ihdg.calendarcolor
  • Processing ch.jiikuy.velocitycalculator
  • Processing ch.logixisland.anuto
  • Processing ch.nexuscomputing.android.osciprimeics
  • Processing ch.phcoder.jigit
  • Processing ch.rmy.android.statusbar_tacho
  • Processing ch.rrelmy.android.batterymanager
  • Processing ch.rrelmy.android.locationcachemap
  • Processing chromiumupdater.bamless.com.chromiumsweupdater
  • Processing click.dummer.UartSmartwatch
  • Processing click.dummer.funphonepuppet
  • Processing click.dummer.rickapp
  • Processing click.dummer.textthing
  • Processing cm.aptoide.pt
  • Processing co.loubo.icicle
  • Processing co.pxhouse.sas
  • Processing co.wakarimasen.ceredux
  • Processing co.wakarimasen.chanexplorer
  • Processing com.Bisha.TI89EmuDonation
  • Processing com.FireFart.Permissions2
  • Processing com.MarcosDiez.shareviahttp
  • Processing com.Pau.ImapNotes2
  • Processing com.SecUpwN.AIMSICD
  • Processing com.a5corp.weather
  • Processing com.aaronjwood.portauthority
  • Processing com.abcdjdj.rootverifier
  • Processing com.abitsinc.andr
  • Processing com.achep.acdisplay
  • Processing com.achep.widget.jellyclock
  • Processing com.actisec.clipcaster
  • Processing com.acvarium.tasclock
  • Processing com.adam.aslfms
  • Processing com.addi
  • Processing com.adonai.manman
  • Processing com.adstrosoftware.launchappops
  • Processing com.afollestad.cabinet
  • Processing com.afollestad.impression
  • Processing com.afollestad.nocknock
  • Processing com.agateau.catgenerator
  • Processing com.agiro.scanner.android
  • Processing com.agnibho.android.solarcompass
  • Processing com.aidinhut.simpletextcrypt
  • Processing com.akop.bach
  • Processing com.alaskalinuxuser.criticalvelocity
  • Processing com.alaskalinuxuser.hourglass
  • Processing com.alaskalinuxuser.justchess
  • Processing com.alaskalinuxuser.justcraigslist
  • Processing com.alaskalinuxuser.justnotes
  • Processing com.alaskalinuxuser.shipcaptainandcrew
  • Processing com.alexcruz.papuhwalls
  • Processing com.alexkang.bluechat
  • Processing com.alexkang.loopboard
  • Processing com.alexkang.x3matrixcalculator
  • Processing com.alexxz.hawkingquotes
  • Processing com.alfray.asqare
  • Processing com.alfray.mandelbrot2
  • Processing com.alfray.timeriffic
  • Processing com.allansimon.verbisteandroid
  • Processing com.almalence.opencam
  • Processing com.amabyte.vtucslabmanual
  • Processing com.amaze.filemanager
  • Processing com.amphoras.tpthelper
  • Processing com.ancantus.HYPNOTOAD
  • Processing com.anddevw.getchromium
  • Processing com.andreasgift.totalzero
  • Processing com.andrew.apollo
  • Processing com.andrewshu.android.reddit
  • Processing com.androguide.universal.init.d
  • Processing com.android.browser
  • Processing com.android.camera2
  • Processing com.android.inputmethod.latin
  • Processing com.android.inputmethod.norwegian
  • Processing com.android.inputmethod.pinyin
  • Processing com.android.keepass
  • Processing com.android.launcher3
  • Processing com.android.music
  • Processing com.android.quake
  • Processing com.android.shellms
  • Processing com.android.talkback
  • Processing com.android2.calculator3
  • Processing com.androidemu.gba
  • Processing com.androidemu.gbc
  • Processing com.androidemu.nes
  • Processing com.androidemu.snes
  • Processing com.androsz.electricsleepbeta
  • Processing com.androzic
  • Processing com.andybotting.tramhunter
  • Processing com.angryburg.uapp
  • Processing com.angrydoughnuts.android.alarmclock
  • Processing com.annie.dictionary
  • Processing com.annimon.minizipandroid
  • Processing com.anoshenko.android.mahjongg
  • Processing com.antoniotari.reactiveampacheapp
  • Processing com.anysoftkeyboard.languagepack.SSH
  • Processing com.anysoftkeyboard.languagepack.basque
  • Processing com.anysoftkeyboard.languagepack.brazilian
  • Processing com.anysoftkeyboard.languagepack.catalan
  • Processing com.anysoftkeyboard.languagepack.danish
  • Processing com.anysoftkeyboard.languagepack.dutch
  • Processing com.anysoftkeyboard.languagepack.esperanto
  • Processing com.anysoftkeyboard.languagepack.french
  • Processing com.anysoftkeyboard.languagepack.french_xlarge
  • Processing com.anysoftkeyboard.languagepack.georgian.fdroid
  • Processing com.anysoftkeyboard.languagepack.german
  • Processing com.anysoftkeyboard.languagepack.greek
  • Processing com.anysoftkeyboard.languagepack.hebrew
  • Processing com.anysoftkeyboard.languagepack.hebrew_large
  • Processing com.anysoftkeyboard.languagepack.hungarian
  • Processing com.anysoftkeyboard.languagepack.icelandic
  • Processing com.anysoftkeyboard.languagepack.italian
  • Processing com.anysoftkeyboard.languagepack.latvian
  • Processing com.anysoftkeyboard.languagepack.macedonian
  • Processing com.anysoftkeyboard.languagepack.malayalam
  • Processing com.anysoftkeyboard.languagepack.neo
  • Processing com.anysoftkeyboard.languagepack.norwegian
  • Processing com.anysoftkeyboard.languagepack.pali
  • Processing com.anysoftkeyboard.languagepack.persian
  • Processing com.anysoftkeyboard.languagepack.portuguese
  • Processing com.anysoftkeyboard.languagepack.russian2
  • Processing com.anysoftkeyboard.languagepack.slovene
  • Processing com.anysoftkeyboard.languagepack.spain
  • Processing com.anysoftkeyboard.languagepack.swedish
  • Processing com.anysoftkeyboard.languagepack.tatar
  • Processing com.anysoftkeyboard.languagepack.ukrainian
  • Processing com.anysoftkeyboard.theme.classic_pc
  • Processing com.aokp.backup
  • Processing com.apkupdater
  • Processing com.app.Zensuren
  • Processing com.app.missednotificationsreminder
  • Processing com.app2go.sudokufree
  • Processing com.appengine.paranoid_android.lost
  • Processing com.appspot.usbhidterminal
  • Processing com.aragaer.jtt
  • Processing com.aripuca.tracker
  • Processing com.ariwilson.seismowallpaper
  • Processing com.arnaud.metronome
  • Processing com.artifex.mupdf.mini
  • Processing com.artifex.mupdf.viewer.app
  • Processing com.artifex.mupdfdemo
  • Processing com.as.anagramsolver
  • Processing com.aselalee.trainschedule
  • Processing com.asksven.betterbatterystats
  • Processing com.asksven.betterwifionoff
  • Processing com.ath0.rpn
  • Processing com.atr.tedit
  • Processing com.axelby.podax
  • Processing com.b44t.messenger
  • Processing com.banasiak.coinflip
  • Processing com.banasiak.coinflipext.example
  • Processing com.bd.gitlab
  • Processing com.bec3.diolite
  • Processing com.bec3.mobilite
  • Processing com.beem.project.beem
  • Processing com.benny.openlauncher
  • Processing com.better.alarm
  • Processing com.bigbluecup.android.launcher
  • Processing com.biglybt.android.client
  • Processing com.bijoysingh.quicknote
  • Processing com.blanyal.remindly
  • Processing com.bleyl.recurrence
  • Processing com.blippex.app
  • Processing com.blntsoft.emailpopup
  • Processing com.blogspot.marioboehmer.nfcprofile
  • Processing com.blogspot.tonyatkins.freespeech
  • Processing com.bmco.cratesiounofficial
  • Processing com.bmpak.anagramsolver
  • Processing com.boardgamegeek
  • Processing com.bobbyrne01.howfardoyouswim
  • Processing com.bonelazy.profileswitcher
  • Processing com.boombuler.games.shift
  • Processing com.boombuler.piraten.map
  • Processing com.boombuler.widgets.contacts
  • Processing com.borneq.heregpslocation
  • Processing com.botbrew.basil
  • Processing com.bottleworks.dailymoney
  • Processing com.boztalay.puppyframeuid
  • Processing com.brapeba.roaminginfo
  • Processing com.brentpanther.bitcoincashwidget
  • Processing com.brentpanther.bitcoinwidget
  • Processing com.brentpanther.ethereumwidget
  • Processing com.brentpanther.litecoinwidget
  • Processing com.bretternst.URLazy
  • Processing com.brewcrewfoo.performance
  • Processing com.bri1.soundbored
  • Processing com.brianco.colorclock
  • Processing com.briankhuu.nfcmessageboard
  • Processing com.brillenheini.deepscratch.free
  • Processing com.brockoli.android.hsdroid
  • Processing com.brocktice.JustSit
  • Processing com.brosmike.airpushdetector
  • Processing com.btcontract.wallet
  • Processing com.btmura.android.reddit
  • Processing com.bvalosek.cpuspy
  • Processing com.bvcode.ncopter
  • Processing com.bwx.bequick
  • Processing com.byagowi.persiancalendar
  • Processing com.bytehamster.changelog
  • Processing com.bytestemplar.tonedef
  • Processing com.cajor.dk.dlna
  • Processing com.call.recorder
  • Processing com.callrecorder.android
  • Processing com.casimirlab.simpleDeadlines
  • Processing com.catchingnow.tinyclipboardmanager
  • Processing com.cebesius.materialhash
  • Processing com.cebesius.wifiautoforget
  • Processing com.cepmuvakkit.times
  • Processing com.cgogolin.library
  • Processing com.chanapps.four.activity
  • Processing com.chdev.ks.minx
  • Processing com.chessclock.android
  • Processing com.chmod0.manpages
  • Processing com.chrisheald.flexauth
  • Processing com.ciarang.tallyphant
  • Processing com.cityfreqs.littlesirecho
  • Processing com.cityzen.cityzen
  • Processing com.claha.showtimeremote
  • Processing com.cleveroad.sample
  • Processing com.clickgostudio.air1072
  • Processing com.code.android.vibevault
  • Processing com.code61.deadpixel
  • Processing com.codebutler.farebot
  • Processing com.coinbase.android
  • Processing com.colinmcdonough.android.torch
  • Processing com.collabora.libreoffice
  • Processing com.color.colornamer
  • Processing com.commit451.gitlab
  • Processing com.commonslab.commonslab
  • Processing com.commonsware.android.arXiv
  • Processing com.concentricsky.android.khan
  • Processing com.corner23.android.beautyclocklivewallpaper
  • Processing com.corphish.nightlight.generic
  • Processing com.coste.syncorg
  • Processing com.cr5315.cfdc
  • Processing com.cradle.iitc_mobile
  • Processing com.crazyhitty.chdev.ks.munch
  • Processing com.csipsimple
  • Processing com.ctrlplusz.dashclock.yr
  • Processing com.cyanogenmod.filemanager.ics
  • Processing com.cyanogenmod.lockclock
  • Processing com.cybrosys.palmcalc
  • Processing com.dacer.simplepomodoro
  • Processing com.dalthed.tucan
  • Processing com.danielkim.soundrecorder
  • Processing com.danielme.muspyforandroid
  • Processing com.danvelazco.fbwrapper
  • Processing com.darknessmap
  • Processing com.darshancomputing.BatteryIndicator
  • Processing com.darshancomputing.BatteryIndicatorPro
  • Processing com.daviancorp.android.mh4udatabase
  • Processing com.daviancorp.android.monsterhunter3udatabase
  • Processing com.davidshewitt.admincontrol
  • Processing com.dconstructing.cooper
  • Processing com.debian.debiandroid
  • Processing com.derek_s.hubble_gallery
  • Processing com.dev.cromer.jason.cshelper
  • Processing com.developfreedom.wordpowermadeeasy
  • Processing com.dftec.planetcon
  • Processing com.dfzlv.gjjlt.caramelos
  • Processing com.dgmltn.morphclock.app
  • Processing com.diegocarloslima.byakugallery
  • Processing com.digitalfishfun.openshift
  • Processing com.digitallizard.nicecompass
  • Processing com.dimtion.shaarlier
  • Processing com.dirkgassen.wator
  • Processing com.dje.openwifinetworkremover
  • Processing com.dkanada.chip
  • Processing com.dkanada.icecons
  • Processing com.dkanada.openapk
  • Processing com.dngames.mobilewebcam
  • Processing com.dnielfe.manager
  • Processing com.docd.purefm
  • Processing com.doomy.overflow
  • Processing com.doomy.torch
  • Processing com.doplgangr.secrecy
  • Processing com.dosse.chromiumautoupdater
  • Processing com.dougkeen.bart
  • Processing com.dozingcatsoftware.asciicam
  • Processing com.dozingcatsoftware.bouncy
  • Processing com.dozingcatsoftware.cameratimer
  • Processing com.dozingcatsoftware.dodge
  • Processing com.dozuki.ifixit
  • Processing com.dp.logcatapp
  • Processing com.drhoffmannsoftware
  • Processing com.dririan.RingyDingyDingy
  • Processing com.drismo
  • Processing com.drodin.tuxrider
  • Processing com.drodin.zxdroid
  • Processing com.droidwave.offlinecalendar
  • Processing com.ds.avare
  • Processing com.duckduckgo.mobile.android
  • Processing com.dwak.lastcall
  • Processing com.dwalkes.android.toggleheadset2
  • Processing com.dwdesign.tweetings
  • Processing com.dynamicg.homebuttonlauncher
  • Processing com.dynamite.heaterrc
  • Processing com.earthblood.tictactoe
  • Processing com.easwareapps.baria
  • Processing com.easwareapps.f2lflap2lock_adfree
  • Processing com.easwareapps.g2l
  • Processing com.easwareapps.marbleone_ad_free
  • Processing com.easwareapps.quoter
  • Processing com.easwareapps.transparentwidget
  • Processing com.easytarget.micopi
  • Processing com.ebaschiera.triplecamel
  • Processing com.ecuamobi.deckwallet
  • Processing com.eddyspace.networkmonitor
  • Processing com.edwardoyarzun.diccionario
  • Processing com.eibriel.reddot
  • Processing com.einmalfel.podlisten
  • Processing com.elementarytoday.theia
  • Processing com.eleybourn.bookcatalogue
  • Processing com.elsdoerfer.android.autostarts
  • Processing com.elsewhat.android.currentwallpaper
  • Processing com.emartynov.android.app.urlsetter
  • Processing com.emmaguy.cleanstatusbar
  • Processing com.endeepak.dotsnsquares
  • Processing com.eneko.hexcolortimewallpaper
  • Processing com.enjoyingfoss.om
  • Processing com.enrico.earthquake.batterysimplysolid
  • Processing com.enrico.earthquake
  • Processing com.enrico.filemanager
  • Processing com.enrico.sample
  • Processing com.eolwral.osmonitor
  • Processing com.episode6.android.appalarm.pro
  • Processing com.etesync.syncadapter
  • Processing com.euedge.openaviationmap.android
  • Processing com.evancharlton.mileage
  • Processing com.evenement.encapsulation
  • Processing com.everysoft.autoanswer
  • Processing com.example.CosyDVR
  • Processing com.example.android.maxpapers
  • Processing com.example.android.monthcalendarwidget
  • Processing com.example.anycut
  • Processing com.example.ismael.downloadfilesweb
  • Processing com.example.lukas.app
  • Processing com.example.muzei.muzeiapod
  • Processing com.example.openpass
  • Processing com.example.root.analyticaltranslator
  • Processing com.example.sshtry
  • Processing com.example.tobiastrumm.freifunkautoconnect
  • Processing com.f.coin
  • Processing com.f0x.eddymalou
  • Processing com.f2prateek.dfg
  • Processing com.fairphone.clock
  • Processing com.fairphone.mycontacts
  • Processing com.fake.android.torchlight
  • Processing com.falconware.prestissimo
  • Processing com.farmerbb.notepad
  • Processing com.farmerbb.taskbar
  • Processing com.fastaccess.github.libre
  • Processing com.fastaccess.github
  • Processing com.fastebro.androidrgbtool
  • Processing com.fgrim.msnake
  • Processing com.fisheradelakin.interactivestory
  • Processing com.fisheradelakin.vortex
  • Processing com.fivasim.antikythera
  • Processing com.flipcamera
  • Processing com.forrestguice.suntimeswidget
  • Processing com.forum.fiend.osp
  • Processing com.foxykeep.lifecounter
  • Processing com.fr3ts0n.androbd.plugin.mqtt
  • Processing com.fr3ts0n.ecu.gui.androbd
  • Processing com.fr3ts0n.stagefever
  • Processing com.frankcalise.h2droid
  • Processing com.freerdp.afreerdp
  • Processing com.freezingwind.animereleasenotifier
  • Processing com.frostwire.android
  • Processing com.frozendevs.cache.cleaner
  • Processing com.frozendevs.periodictable
  • Processing com.frrahat.quransimple
  • Processing com.fsck.k9.material
  • Processing com.fsck.k9
  • Processing com.fullscreen
  • Processing com.funambol.androidsync
  • Processing com.fusionx.lightirc
  • Processing com.futonredemption.mylocation
  • Processing com.futurice.android.reservator
  • Processing com.gabm.fancyplaces
  • Processing com.gabm.screenrotationcontrol
  • Processing com.gacode.relaunchx
  • Processing com.games.boardgames.aeonsend
  • Processing com.gcstar.scanner
  • Processing com.gcstar.viewer
  • Processing com.geecko.QuickLyric
  • Processing com.gelakinetic.mtgfam
  • Processing com.genonbeta.TrebleShot
  • Processing com.germainz.identiconizer
  • Processing com.gh4a
  • Processing com.ghisguth.sun
  • Processing com.ghostsq.commander.https
  • Processing com.ghostsq.commander.samba
  • Processing com.ghostsq.commander.sftp
  • Processing com.ghostsq.commander
  • Processing com.ghstudios.android.mhgendatabase
  • Processing com.gimranov.zandy.app
  • Processing com.ginkel.hashit
  • Processing com.github.alijc.cricketsalarm
  • Processing com.github.andlyticsproject
  • Processing com.github.axet.audiorecorder
  • Processing com.github.axet.binauralbeats
  • Processing com.github.axet.bookreader
  • Processing com.github.axet.callrecorder
  • Processing com.github.axet.hourlyreminder
  • Processing com.github.axet.maps
  • Processing com.github.axet.mover
  • Processing com.github.axet.tonegenerator
  • Processing com.github.axet.torrentclient
  • Processing com.github.cetoolbox
  • Processing com.github.cythara
  • Processing com.github.darthjoey91.hangman
  • Processing com.github.dfa.diaspora_android
  • Processing com.github.egonw.isotopes
  • Processing com.github.funkyg.funkytunes
  • Processing com.github.gianlucanitti.expreval
  • Processing com.github.grimpy.botifier
  • Processing com.github.jtjj222.sudburytransit
  • Processing com.github.marmalade.aRevelation
  • Processing com.github.mobile
  • Processing com.github.mofosyne.instantreadme
  • Processing com.github.mofosyne.tagdrop
  • Processing com.github.mueller_ma.viewandroidversion
  • Processing com.github.nicolassmith.urlevaluator
  • Processing com.github.notizklotz.derbunddownloader
  • Processing com.github.nutomic.controldlna
  • Processing com.github.onetimepass
  • Processing com.github.ooz.heymeditation
  • Processing com.github.pires.obd.reader
  • Processing com.github.pockethub.android
  • Processing com.github.premnirmal.tickerwidget
  • Processing com.github.quarck.calnotify
  • Processing com.github.redpanal.android
  • Processing com.github.ruleant.getback_gps
  • Processing com.github.sryze.wirebug
  • Processing com.github.timnew.smartremotecontrol
  • Processing com.github.wakhub.tinyclock
  • Processing com.github.wdkapps.fillup
  • Processing com.github.xloem.qrstream
  • Processing com.github.yeriomin.dumbphoneassistant
  • Processing com.github.yeriomin.smsscheduler
  • Processing com.github.yeriomin.workoutlog
  • Processing com.github.yeriomin.yalpstore
  • Processing com.gitlab.ardash.appleflinger.android
  • Processing com.gk.simpleworkoutjournal
  • Processing com.glTron
  • Processing com.gladis.tictactoe
  • Processing com.glanznig.beepme
  • Processing com.gluegadget.hndroid
  • Processing com.gmail.afonsotrepa.pocketgopher
  • Processing com.gmail.altakey.effy
  • Processing com.gmail.charleszq
  • Processing com.gmail.jerickson314.sdscanner
  • Processing com.gmail.mugcuposup.android
  • Processing com.gmail.walles.johan.batterylogger
  • Processing com.gokhanmoral.stweaks.app
  • Processing com.goltzkiste.guessaday
  • Processing com.googamaphone.typeandspeak
  • Processing com.google.android.accessibility.talkback
  • Processing com.google.android.apps.authenticator2
  • Processing com.google.android.apps.iosched
  • Processing com.google.android.diskusage
  • Processing com.google.android.gms
  • Processing com.google.android.location
  • Processing com.google.android.maps.mytracks
  • Processing com.google.android.marvin.talkback
  • Processing com.google.android.stardroid
  • Processing com.google.code.apps2org
  • Processing com.google.code.appsorganizer
  • Processing com.google.code.geobeagle
  • Processing com.google.marvin.shell
  • Processing com.google.zxing.client.android
  • Processing com.googlecode.android.wifi.tether
  • Processing com.googlecode.android_scripting
  • Processing com.googlecode.awsms
  • Processing com.googlecode.chartdroid
  • Processing com.googlecode.droidwall
  • Processing com.googlecode.eyesfree.espeak
  • Processing com.googlecode.gogodroid
  • Processing com.googlecode.gtalksms
  • Processing com.googlecode.networklog
  • Processing com.googlecode.openwnn.legacy
  • Processing com.googlecode.tcime
  • Processing com.gpl.rpg.AndorsTrail
  • Processing com.gpstether
  • Processing com.gracecode.android.presentation
  • Processing com.grapefruitopia.dashclock.k9
  • Processing com.grarak.kerneladiutor
  • Processing com.greenaddress.abcore
  • Processing com.greenaddress.greenbits_android_wallet.testnet
  • Processing com.greenaddress.greenbits_android_wallet
  • Processing com.gregorywlodarek.torontotransit.torontotransit
  • Processing com.gs.mobileprint
  • Processing com.gtp.showapicturetoyourfriend
  • Processing com.gueei.applocker
  • Processing com.gulshansingh.hackerlivewallpaper
  • Processing com.gunshippenguin.openflood
  • Processing com.guvery.notifyme
  • Processing com.haha01haha01.harail
  • Processing com.harasoft.relaunch
  • Processing com.haringeymobile.ukweather
  • Processing com.harleensahni.android.mbr
  • Processing com.hasi.hasid00r
  • Processing com.hayaisoftware.launcher
  • Processing com.health.openscale
  • Processing com.hectorone.multismssender
  • Processing com.hermit.btreprap
  • Processing com.hexad.bluezime.hidenabler
  • Processing com.hexad.bluezime
  • Processing com.hexairbot.hexmini
  • Processing com.hlidskialf.android.pomodoro
  • Processing com.hobbyone.HashDroid
  • Processing com.holokenmod
  • Processing com.horaapps.leafpic
  • Processing com.howeyc.spiped
  • Processing com.htruong.inputmethod.latin
  • Processing com.hughes.android.dictionary
  • Processing com.hykwok.CurrencyConverter
  • Processing com.hyperionics.fbreader.plugin.tts_plus
  • Processing com.iamtrk.androidexplorer
  • Processing com.iazasoft.footguy
  • Processing com.icechen1.notable.pro
  • Processing com.icecondor.nest
  • Processing com.ichi2.anki
  • Processing com.ideasfrombrain.search_based_launcher_v2
  • Processing com.idunnololz.igo
  • Processing com.igisw.openmoneybox
  • Processing com.igormaznitsa.piratedice
  • Processing com.ihunda.android.binauralbeat
  • Processing com.ilm.sandwich
  • Processing com.infonuascape.osrshelper
  • Processing com.innodroid.mongobrowser
  • Processing com.integralblue.callerid
  • Processing com.intervigil.micdroid
  • Processing com.intrications.android.sharebrowser
  • Processing com.invano.ambientweather
  • Processing com.irahul.worldclock
  • Processing com.isaacparker.dozesettingseditor
  • Processing com.isanexusdev.androidcpg
  • Processing com.isdp.trirose
  • Processing com.iskrembilen.quasseldroid
  • Processing com.itds.sms.ping
  • Processing com.ivanvolosyuk.sharetobrowser
  • Processing com.iven.lfflfeedreader
  • Processing com.iven.xdafeedreader
  • Processing com.jackpf.apkdownloader
  • Processing com.jadn.cc
  • Processing com.jakebasile.android.hearingsaver
  • Processing com.jakewharton.telecine
  • Processing com.jarsilio.android.pocketup
  • Processing com.jarsilio.android.scrambledeggsif
  • Processing com.jarsilio.android.waveup
  • Processing com.java.SmokeReducer
  • Processing com.javierllorente.adc
  • Processing com.javiersantos.mlmanager
  • Processing com.javiersantos.mlmanagerpro
  • Processing com.javiersantos.whatsappbetaupdater
  • Processing com.jaygoel.virginminuteschecker
  • Processing com.jbirdvegas.mgerrit
  • Processing com.jecelyin.editor
  • Processing com.jeffboody.GearsES2eclair
  • Processing com.jefftharris.passwdsafe
  • Processing com.jelly.theme.revenge
  • Processing com.jereksel.libresubstratum
  • Processing com.jeyries.quake2
  • Processing com.jforce.chapelhillnextbus
  • Processing com.jlyr
  • Processing com.jmartin.temaki
  • Processing com.jmartin.writeily
  • Processing com.jmelzer.myttr
  • Processing com.jmstudios.chibe
  • Processing com.jmstudios.pointandhit.android
  • Processing com.jmstudios.redmoon
  • Processing com.johan.vertretungsplan
  • Processing com.jonbanjo.cupsprintservice
  • Processing com.jonglen7.jugglinglab
  • Processing com.jorgecastillo.kanadrill
  • Processing com.josegd.monthcalwidget
  • Processing com.joshtwigg.cmus.droid
  • Processing com.jotabout.screeninfo
  • Processing com.joulespersecond.seattlebusbot
  • Processing com.jparkie.aizoban
  • Processing com.jparkie.givesmehope
  • Processing com.jpkrause.c_feed
  • Processing com.jtechme.jumpgo
  • Processing com.jtmcn.archwiki.viewer
  • Processing com.juet.attendance
  • Processing com.juliansparber.captiveportallogin
  • Processing com.junjunguo.pocketmaps
  • Processing com.jwetherell.heart_rate_monitor
  • Processing com.kaeruct.glxy
  • Processing com.kai1973i
  • Processing com.kanedias.vanilla.audiotag
  • Processing com.kanedias.vanilla.coverfetch
  • Processing com.kanedias.vanilla.lyrics
  • Processing com.kaneoriley.cyanogenport.launcher3
  • Processing com.kennyc.open.imgur
  • Processing com.keylesspalace.tusky
  • Processing com.khuttun.notificationnotes
  • Processing com.kibab.android.EncPassChanger
  • Processing com.kirit.android.mintercept
  • Processing com.kkinder.charmap
  • Processing com.kkinder.sharelocation
  • Processing com.kmagic.solitaire
  • Processing com.kn.paper_foss_theme
  • Processing com.knirirr.beecount
  • Processing com.kodarkooperativet.notificationstopwatch
  • Processing com.kodis
  • Processing com.kostmo.wallpaper.spiral
  • Processing com.koushikdutta.superuser
  • Processing com.kpz.pomodorotasks.activity
  • Processing com.kunzisoft.keepass.libre
  • Processing com.kure.musicplayer
  • Processing com.kvance.Nectroid
  • Processing com.kyakujin.android.tagnotepad
  • Processing com.launcher.silverfish
  • Processing com.leafdigital.kanji.android
  • Processing com.leafpic.app
  • Processing com.lecz.android.tiltmazes
  • Processing com.leinardi.kitchentimer
  • Processing com.leocardz.multitouch.test
  • Processing com.leocardz.url.unshortener
  • Processing com.lgallardo.qbittorrentclient
  • Processing com.lgallardo.qbittorrentclientpro
  • Processing com.liato.bankdroid
  • Processing com.lightbox.android.camera
  • Processing com.linkomnia.android.Changjie
  • Processing com.linuxcounter.lico_update_003
  • Processing com.litmus.worldscope
  • Processing com.littlebytesofpi.pylauncher
  • Processing com.liveplayergames.finneypoker
  • Processing com.llamacorp.equate
  • Processing com.lligainterm
  • Processing com.lonepulse.travisjr
  • Processing com.longevitysoft.android.appwidget.hstfeed
  • Processing com.lostrealm.lembretes
  • Processing com.lucasdnd.bitclock16
  • Processing com.lucasdnd.decimaltimeclockwidget
  • Processing com.lucasdnd.unixtimeclockwidget
  • Processing com.luk.timetable2
  • Processing com.lukekorth.screennotifications
  • Processing com.luorrak.ouroboros
  • Processing com.madgag.agit
  • Processing com.majeur.applicationsinfo
  • Processing com.makeinfo.sudokugenerator
  • Processing com.malek.alldebrid
  • Processing com.manichord.mgit
  • Processing com.manor.currentwidget
  • Processing com.mantz_it.rfanalyzer
  • Processing com.manuelmaly.hn
  • Processing com.mapswithme.maps.libre
  • Processing com.maralexbar.wifikeyview
  • Processing com.marceljurtz.lifecounter
  • Processing com.mareksebera.simpledilbert
  • Processing com.mariogrip.octoprint
  • Processing com.markusborg.test
  • Processing com.markuspage.android.atimetracker
  • Processing com.markuspage.android.certtools
  • Processing com.martinborjesson.o2xtouchlednotifications
  • Processing com.maskyn.fileeditorpro
  • Processing com.matburt.mobileorg
  • Processing com.matejdro.pebbledialer
  • Processing com.materialos.cm.theme
  • Processing com.mathi_amorim.emmanuel.metrictime
  • Processing com.matoski.adbm
  • Processing com.mattallen.dpixel
  • Processing com.mattallen.loaned
  • Processing com.matteopacini.katana
  • Processing com.mattermost.mattermost
  • Processing com.mattgmg.miracastwidget
  • Processing com.mattieapps.roommates
  • Processing com.max2idea.android.fwknop
  • Processing com.maxfierke.sandwichroulette
  • Processing com.mde.potdroid
  • Processing com.mehmetakiftutuncu.eshotroid
  • Processing com.mendhak.gpslogger
  • Processing com.menny.android.anysoftkeyboard
  • Processing com.menny.anysoftkeyboard.finnish
  • Processing com.metinkale.prayer
  • Processing com.mfreitas.twister
  • Processing com.mgaetan89.showsrage
  • Processing com.michaldabski.filemanager
  • Processing com.midisheetmusic
  • Processing com.mikifus.padland
  • Processing com.mill_e.twitterwrapper
  • Processing com.miqote.angelplayerwp
  • Processing com.miqote.brswp
  • Processing com.miqote.shanawp
  • Processing com.miracleas.bitcoin_spinner
  • Processing com.mirasmithy.epochlauncher
  • Processing com.mitzuli
  • Processing com.miz.mizuu
  • Processing com.mkf.droidsat
  • Processing com.mkulesh.micromath.plus
  • Processing com.mobilepearls.memory
  • Processing com.mobilepearls.sokoban
  • Processing com.mobiperf
  • Processing com.mod.android.widget.fbcw
  • Processing com.moez.QKSMS
  • Processing com.mohammadag.beamfile
  • Processing com.monead.games.android.sequence
  • Processing com.money.manager.ex
  • Processing com.moonpi.swiftnotes
  • Processing com.moonpi.tapunlock
  • Processing com.morlunk.mountie
  • Processing com.morlunk.mumbleclient
  • Processing com.morphoss.acal
  • Processing com.movim.movim
  • Processing com.mp3tunes.android.player
  • Processing com.mrbimc.selinux
  • Processing com.mridang.cellinfo
  • Processing com.mridang.speedo
  • Processing com.mridang.throttle
  • Processing com.mridang.wifiinfo
  • Processing com.msapps.touchdetector
  • Processing com.mschlauch.comfortreader
  • Processing com.murrayc.galaxyzoo.app
  • Processing com.mustafaali.sensorssandbox
  • Processing com.mykola.lexinproject
  • Processing com.myopicmobile.textwarrior.android
  • Processing com.nagopy.android.disablemanager2
  • Processing com.naholyr.android.horairessncf
  • Processing com.naman14.stools
  • Processing com.namelessdev.mpdroid
  • Processing com.namsor.api.samples.gendre
  • Processing com.nanoconverter.zlab
  • Processing com.nathanosman.chronosnap
  • Processing com.nauj27.android.colorpicker
  • Processing com.nbossard.packlist
  • Processing com.nephoapp.anarxiv
  • Processing com.nesswit.galbijjimsearcher
  • Processing com.netthreads.android.noiz2
  • Processing com.newsblur
  • Processing com.nexes.manager
  • Processing com.nextcloud.android.beta
  • Processing com.nextcloud.client
  • Processing com.nextcloud.talk2
  • Processing com.nextgis.mobile
  • Processing com.nhellfire.kerneladiutor
  • Processing com.nicue.onetwo
  • Processing com.nightshadelabs.anotherbrowser
  • Processing com.nilhcem.frcndict
  • Processing com.nilhcem.hostseditor
  • Processing com.niparasc.papanikolis
  • Processing com.nkanaev.comics
  • Processing com.nltechno.dolidroidpro
  • Processing com.nma.util.sdcardtrac
  • Processing com.nolanlawson.apptracker
  • Processing com.nolanlawson.chordreader
  • Processing com.nolanlawson.jnameconverter
  • Processing com.nolanlawson.keepscore
  • Processing com.nolanlawson.logcat
  • Processing com.nononsenseapps.feeder
  • Processing com.nononsenseapps.notepad
  • Processing com.nooskewl.bobby
  • Processing com.noshufou.android.su
  • Processing com.nostra13.universalimageloader
  • Processing com.notecryptpro
  • Processing com.notriddle.budget
  • Processing com.notriddle.null_launcer
  • Processing com.nowsecure.android.vts
  • Processing com.npi.muzeiflickr
  • Processing com.nucc.hackwinds
  • Processing com.numguesser.tonio_rpchp.numberguesser
  • Processing com.numix.calculator
  • Processing com.numix.icons_circle
  • Processing com.nutomic.ensichat
  • Processing com.nutomic.syncthingandroid
  • Processing com.nutomic.zertman
  • Processing com.oakley.fon
  • Processing com.ogsdroid
  • Processing com.olam
  • Processing com.omegavesko.holocounter
  • Processing com.omegavesko.sutransplus
  • Processing com.onest8.onetimepad
  • Processing com.onetwofivegames.kungfoobarracuda
  • Processing com.opendoorstudios.ds4droid
  • Processing com.opentaxi.android
  • Processing com.orgzly
  • Processing com.orphan.amplayer
  • Processing com.orpheusdroid.screenrecorder
  • Processing com.osmnavigator
  • Processing com.owncloud.android
  • Processing com.packetsender.android
  • Processing com.palliser.nztides
  • Processing com.panaceasupplies.android.games.toytrain
  • Processing com.paranoid.ParanoidWallpapers
  • Processing com.passcard
  • Processing com.pavelsikun.runinbackgroundpermissionsetter
  • Processing com.pcinpact
  • Processing com.peppercarrot.runninggame
  • Processing com.pheelicks.visualizer
  • Processing com.phg.constellations
  • Processing com.phikal.regex
  • Processing com.philliphsu.clock2
  • Processing com.phpsysinfo
  • Processing com.physphil.android.unitconverterultimate
  • Processing com.pierceholdings.dontpause
  • Processing com.pierreduchemin.punchlinebingo
  • Processing com.pikselbit.wrongpinshutdown
  • Processing com.pilockerstable
  • Processing com.pilot51.voicenotify
  • Processing com.pindroid
  • Processing com.piratebayfree
  • Processing com.piwi.stickeroid
  • Processing com.pixiv.muzei.pixivsource
  • Processing com.pjuu.droidotter
  • Processing com.pjuu.otterdroid
  • Processing com.platypus.SAnd
  • Processing com.platypus.dicer
  • Processing com.plusonelabs.calendar
  • Processing com.poinsart.votar
  • Processing com.polipoid
  • Processing com.politedroid
  • Processing com.poloure.simplerss
  • Processing com.poupa.vinylmusicplayer
  • Processing com.powerje.nyan
  • Processing com.powerpoint45.lucidbrowser
  • Processing com.prhlt.aemus.Read4SpeechExperiments
  • Processing com.primavera.arduino.listener
  • Processing com.primokorn.enhancement
  • Processing com.proch.practicehub
  • Processing com.projectsexception.myapplist.open
  • Processing com.purplefoto.pfdock
  • Processing com.qsp.player
  • Processing com.quaap.audiometer
  • Processing com.quaap.bookymcbookface
  • Processing com.quaap.computationaldemonology
  • Processing com.quaap.dodatheexploda
  • Processing com.quaap.fishberserker
  • Processing com.quaap.launchtime
  • Processing com.quaap.phonefonefun
  • Processing com.quaap.primary
  • Processing com.qubling.sidekick
  • Processing com.quran.labs.androidquran
  • Processing com.radioreddit.android
  • Processing com.radiostudent.radiostudentstream
  • Processing com.rareventure.gps2
  • Processing com.rascarlo.aurdroid
  • Processing com.rastating.droidbeard
  • Processing com.ratebeer.android
  • Processing com.readystatesoftware.ghostlog
  • Processing com.reddyetwo.hashmypass.app
  • Processing com.redirectapps.tvkill
  • Processing com.refactech.driibo
  • Processing com.rehanced.lunary
  • Processing com.reicast.emulator
  • Processing com.renard.ocr
  • Processing com.repay.android
  • Processing com.replica.replicaisland
  • Processing com.retroarch
  • Processing com.rfo.basic
  • Processing com.rhiannonweb.android.migrainetracker
  • Processing com.ridgelineapps.resdicegame
  • Processing com.rigid.birthdroid
  • Processing com.ringdroid
  • Processing com.rj.pixelesque
  • Processing com.robert.maps
  • Processing com.rockbyte.arxiv
  • Processing com.rogerbassonsrenart.paddletennis
  • Processing com.roguetemple.hydroid
  • Processing com.roguetemple.hyperroid
  • Processing com.roozen.SoundManagerv2
  • Processing com.rubenroy.minimaltodo
  • Processing com.rubenwardy.minetestmodmanager
  • Processing com.ruesga.android.wallpapers.photophase
  • Processing com.sagar.screenshift2
  • Processing com.saha.batchuninstaller
  • Processing com.saibotd.bitbeaker
  • Processing com.sakthipriyan.cricscore
  • Processing com.saladdressing.veterondo
  • Processing com.sam.hex
  • Processing com.samebits.beacon.locator
  • Processing com.samsandberg.mtafarebuster
  • Processing com.samsung.srpol
  • Processing com.samwhited.opensharelocationplugin
  • Processing com.sandeel.bushidoblocks
  • Processing com.sapientech.mediagoblin
  • Processing com.sapos_aplastados.game.clash_of_balls
  • Processing com.scar45.aokp.co.webviewer
  • Processing com.scottmain.android.searchlight
  • Processing com.seafile.seadroid
  • Processing com.seafile.seadroid2
  • Processing com.seavenois.tetris
  • Processing com.seawolfsanctuary.keepingtracks
  • Processing com.seb.SLWP
  • Processing com.seb.SLWPmaps
  • Processing com.secuso.privacyFriendlyCodeScanner
  • Processing com.secuso.torchlight2
  • Processing com.selbie.wrek
  • Processing com.selesca.xkcdmuzei
  • Processing com.semche.invasion
  • Processing com.sensirion.smartgadget
  • Processing com.serone.desktoplabel
  • Processing com.serwylo.lexica
  • Processing com.serwylo.msjviewer
  • Processing com.sevag.pitcha
  • Processing com.sevag.unrealtracker
  • Processing com.sgr_b2.compass
  • Processing com.shadcat.secdroid
  • Processing com.shahul3d.indiasatelliteweather
  • Processing com.shanewmiller.gorecompanion
  • Processing com.shapps.mintubeapp
  • Processing com.shatteredpixel.shatteredpixeldungeon
  • Processing com.shkmishra.lyrically
  • Processing com.showmehills
  • Processing com.shurik.droidzebra
  • Processing com.sidzi.circleofmusic
  • Processing com.sigseg.android.worldmap
  • Processing com.silentlexx.instead
  • Processing com.silverkeytech.android_rivers
  • Processing com.simplemobiletools.applauncher
  • Processing com.simplemobiletools.calculator
  • Processing com.simplemobiletools.calendar
  • Processing com.simplemobiletools.camera
  • Processing com.simplemobiletools.clock
  • Processing com.simplemobiletools.contacts
  • Processing com.simplemobiletools.draw
  • Processing com.simplemobiletools.filemanager
  • Processing com.simplemobiletools.flashlight
  • Processing com.simplemobiletools.gallery
  • Processing com.simplemobiletools.musicplayer
  • Processing com.simplemobiletools.notes
  • Processing com.simplemobiletools.thankyou
  • Processing com.sinpo.xnfc
  • Processing com.sismics.reader
  • Processing com.slash.batterychargelimit
  • Processing com.sli.juicymobile
  • Processing com.sli.ohmcalc
  • Processing com.slothwerks.hearthstone.compendiumforhearthstone
  • Processing com.smerty.ham
  • Processing com.smithdtyler.prettygoodmusicplayer.launchermode
  • Processing com.smithdtyler.prettygoodmusicplayer
  • Processing com.smorgasbork.hotdeath
  • Processing com.snaheth.trulyrandom
  • Processing com.sound.ampache
  • Processing com.soyblue.bluesound
  • Processing com.spartan.headsupgeocaching
  • Processing com.spazedog.mounts2sd
  • Processing com.sputnik.wispr
  • Processing com.spydiko.rotationmanager_foss
  • Processing com.ssaurel.clocklw
  • Processing com.stevenschoen.putionew
  • Processing com.stoutner.privacybrowser.standard
  • Processing com.studio332.flickit.android
  • Processing com.studio332.flickit
  • Processing com.stwalkerster.android.apps.strobelight
  • Processing com.styrkurapp.app
  • Processing com.sunshine.makilite
  • Processing com.sunyata.kindmind
  • Processing com.sweetiepiggy.everylocale
  • Processing com.swiss.tournament
  • Processing com.syncedsynapse.kore2
  • Processing com.taiste.lainari_en
  • Processing com.tananaev.logcat
  • Processing com.tasomaniac.dashclock.hackerspace.floss
  • Processing com.tasomaniac.openwith.floss
  • Processing com.tassadar.multirommgr
  • Processing com.tastycactus.timesheet
  • Processing com.teamdc.stephendiniz.autoaway
  • Processing com.teeworlds
  • Processing com.teleca.jamendo
  • Processing com.templaro.opsiz.aka
  • Processing com.ten15.diyfish
  • Processing com.tengu.sharetoclipboard
  • Processing com.termux.api
  • Processing com.termux.boot
  • Processing com.termux.styling
  • Processing com.termux.tasker
  • Processing com.termux
  • Processing com.termux.widget
  • Processing com.termux.window
  • Processing com.textuality.lifesaver2
  • Processing com.th.XenonWallpapers
  • Processing com.thefonz.ed_tool
  • Processing com.thehoick.evergreenwishlist
  • Processing com.theksmith.android.car_bus_interface
  • Processing com.thermatk.android.xf.fakegapps
  • Processing com.thibaudperso.sonycamera
  • Processing com.threedlite.livePolys
  • Processing com.threedlite.urforms
  • Processing com.threedlite.userhash.location
  • Processing com.tierep.notificationanalyser
  • Processing com.timvdalen.gizmooi
  • Processing com.tinkerlog.android.pongtime
  • Processing com.tjm.crushr
  • Processing com.tjm.stripepaper
  • Processing com.tkjelectronics.balanduino
  • Processing com.tmarki.comicmaker
  • Processing com.tmendes.birthdaydroid
  • Processing com.tmendes.dadosd
  • Processing com.tnc.android.graphite
  • Processing com.tobiaskuban.android.monthcalendarwidgetfoss
  • Processing com.tobykurien.batteryfu
  • Processing com.tobykurien.google_news
  • Processing com.tobykurien.webapps
  • Processing com.todobom.opennotescanner
  • Processing com.tomaszmarzeion.notepad
  • Processing com.tomatodev.timerdroid
  • Processing com.tomer.alwayson
  • Processing com.tomer.dbz.widget
  • Processing com.tomer.draw
  • Processing com.tomer.poke.notifier
  • Processing com.tomer.screenshotsharer
  • Processing com.tortel.syslog
  • Processing com.tortuca.holoken
  • Processing com.totsp.bookworm
  • Processing com.totsp.crossword.shortyz
  • Processing com.toxtox.philosopherstonewidget
  • Processing com.traffar.a24game
  • Processing com.traffar.game_of_life
  • Processing com.traffar.gomoku
  • Processing com.traffar.oware
  • Processing com.traffar.pentago
  • Processing com.tritop.androsense2
  • Processing com.tttdevs.stncbookmarks
  • Processing com.tum.yahtzee
  • Processing com.tunes.viewer
  • Processing com.turtleplayerv2
  • Processing com.twinone.locker
  • Processing com.twistedplane.sealnote
  • Processing com.twobuntu.twobuntu
  • Processing com.twofours.surespot
  • Processing com.twolinessoftware.android
  • Processing com.twsitedapps.homemanager
  • Processing com.u17od.upm
  • Processing com.ubergeek42.WeechatAndroid
  • Processing com.uberspot.a2048
  • Processing com.ubuntuone.android.files
  • Processing com.ultrafunk.network_info
  • Processing com.ultramegatech.ey
  • Processing com.umang.dashnotifier
  • Processing com.unitedcoders.android.gpodroid
  • Processing com.unleashyouradventure.swaccess
  • Processing com.unwind.networkmonitor
  • Processing com.unwrappedapps.android.wallpaper.creative
  • Processing com.uploadedlobster.PwdHash
  • Processing com.uraroji.garage.android.mp3recvoice
  • Processing com.ushahidi.android.app
  • Processing com.utyf.pmetro
  • Processing com.vackosar.searchbasedlauncher
  • Processing com.vadimfrolov.duorem
  • Processing com.valleytg.oasvn.android
  • Processing com.vanderbie.heart_rate_monitor
  • Processing com.veken0m.bitcoinium
  • Processing com.veniosg.dir
  • Processing com.vgorcum.minedmonero
  • Processing com.viper.simplert
  • Processing com.vlath.beheexplorer
  • Processing com.vlath.keyboard
  • Processing com.vlille.checker
  • Processing com.vmihalachi.turboeditor
  • Processing com.vocifery.daytripper
  • Processing com.voidcode.diasporawebclient
  • Processing com.volosyukivan
  • Processing com.vonglasow.michael.qz
  • Processing com.vonglasow.michael.satstat
  • Processing com.vrem.wifianalyzer
  • Processing com.vsmartcard.acardemulator
  • Processing com.vsmartcard.remotesmartcardreader.app
  • Processing com.vuze.android.remote
  • Processing com.vwp.locdemo
  • Processing com.vwp.owmap
  • Processing com.vwp.owmini
  • Processing com.wabadaba.dziennik
  • Processing com.waist.line
  • Processing com.wanderfar.expander
  • Processing com.wangdaye.mysplash
  • Processing com.wanghaus.remembeer
  • Processing com.watabou.pixeldungeon
  • Processing com.wbrenna.gtfsoffline
  • Processing com.weatherlight.elloshare
  • Processing com.webworxshop.swallowcatcher
  • Processing com.weicheng.taipeiyoubikeoffline
  • Processing com.wentam.defcol
  • Processing com.wikaba.ogapp
  • Processing com.wikijourney.wikijourney
  • Processing com.willhauck.linconnectclient
  • Processing com.willianveiga.countdowntimer
  • Processing com.wireguard.android
  • Processing com.wmstein.tourcount
  • Processing com.wmstein.transektcount
  • Processing com.woefe.shoppinglist
  • Processing com.wolas.awesomewallpaper
  • Processing com.wordpress.chislonchow.legacylauncher
  • Processing com.wordpress.sarfraznawaz.callerdetails
  • Processing com.workingagenda.democracydroid
  • Processing com.workingagenda.devinettes
  • Processing com.workingagenda.fissure
  • Processing com.write.Quill
  • Processing com.xabber.android.classic
  • Processing com.xabber.androiddev
  • Processing com.xargsgrep.portknocker
  • Processing com.xatik.app.droiddraw.client
  • Processing com.xda.theme.cyanogenmod
  • Processing com.xenris.liquidwarsos
  • Processing com.xlythe.calculator.material
  • Processing com.xlythe.minecraftclock
  • Processing com.xmission.trevin.android.todo
  • Processing com.xperia64.timidityae
  • Processing com.yasfa.views
  • Processing com.yassirh.digitalocean
  • Processing com.ymber.eleven
  • Processing com.yubico.yubiclip
  • Processing com.yubico.yubioath
  • Processing com.yubico.yubitotp
  • Processing com.zachrattner.pockettalk
  • Processing com.zagayevskiy.pacman
  • Processing com.zapta.apps.maniana
  • Processing com.zaren
  • Processing com.zeapo.pwdstore
  • Processing com.zegoggles.gist
  • Processing com.zegoggles.smssync
  • Processing com.zenstyle.muzei.wlppr
  • Processing com.zoffcc.applications.aagtl

...checkupdate failed for com.zoffcc.applications.aagtl : [SSL: CERTIFICATE_VERIFY_FAILED] certificate verify failed (_ssl.c:777)

  • Processing com.zoffcc.applications.trifa
  • Processing com.zoffcc.applications.zanavi
  • Processing com.zola.bmi
  • Processing community.fairphone.clock
  • Processing community.fairphone.fplauncher3
  • Processing community.fairphone.mycontacts
  • Processing community.peers.internetradio
  • Processing community.peers.license
  • Processing cri.sanity
  • Processing cs4295.memecreator
  • Processing csci567.squeez
  • Processing csd.qtproject.minesweeper
  • Processing csh.cryptonite
  • Processing cx.hell.android.pdfview
  • Processing cx.hell.android.pdfviewpro
  • Processing cx.mccormick.pddroidparty
  • Processing cx.ring
  • Processing cxa.gridwallpaper
  • Processing cxa.lineswallpaper
  • Processing cz.antecky.netswitch
  • Processing cz.eutopia.snooperstopper
  • Processing cz.hejl.chesswalk
  • Processing cz.jiriskorpil.amixerwebui
  • Processing cz.jirkovsky.lukas.chmupocasi
  • Processing cz.martykan.forecastie
  • Processing cz.martykan.webtube
  • Processing cz.nic.turris
  • Processing cz.romario.opensudoku
  • Processing cz.yetanotherview.webcamviewer.app
  • Processing damo.three.ie
  • Processing daniel_32.flexiblewallpaper
  • Processing dasher.android
  • Processing de.Cherubin7th.blackscreenpresentationremote
  • Processing de.agrothe.go
  • Processing de.antonfluegge.android.yubnubwidgetadfree
  • Processing de.antonwolf.agendawidget
  • Processing de.arnefeil.bewegungsmelder
  • Processing de.arnowelzel.android.periodical
  • Processing de.audioattack.openlink
  • Processing de.audioattack.yacy31c3search
  • Processing de.audioattack.yacy32c3search
  • Processing de.azapps.mirakel.dashclock
  • Processing de.azapps.mirakelandroid
  • Processing de.b0nk.fp1_epo_autoupdate
  • Processing de.badaix.snapcast
  • Processing de.bashtian.dashclocksunrise
  • Processing de.baumann.browser
  • Processing de.baumann.diaspora
  • Processing de.baumann.hhsmoodle
  • Processing de.baumann.pdfcreator
  • Processing de.baumann.quitsmoking
  • Processing de.baumann.sieben
  • Processing de.baumann.thema
  • Processing de.baumann.weather
  • Processing de.benibela.videlibri
  • Processing de.bitsharesmunich.smartcoinswallet
  • Processing de.bitsharesmunich.wallet
  • Processing de.bjusystems.vdrmanager
  • Processing de.blau.android
  • Processing de.blinkt.openvpn
  • Processing de.boesling.hydromemo
  • Processing de.c3nav.droid
  • Processing de.chaosdorf.meteroid
  • Processing de.christinecoenen.code.zapp
  • Processing de.cketti.dashclock.k9
  • Processing de.clemensbartz.android.launcher
  • Processing de.cryptobitch.muelli.barcodegen
  • Processing de.cryptobitch.muelli.vouchercalc
  • Processing de.cwde.freeshisen
  • Processing de.cweiske.headphoneindicator
  • Processing de.d120.ophasekistenstapeln
  • Processing de.danielweisser.android.ldapsync
  • Processing de.danoeh.antennapod
  • Processing de.delusions.measure
  • Processing de.devisnik.android.sliding
  • Processing de.devmil.muzei.bingimageofthedayartsource
  • Processing de.devmil.paperlaunch
  • Processing de.digisocken.anotherrss
  • Processing de.digisocken.openwort
  • Processing de.digisocken.reotwe
  • Processing de.dotwee.micropinner
  • Processing de.drhoffmannsoft.pizza
  • Processing de.drhoffmannsoftware
  • Processing de.drhoffmannsoftware.xearth
  • Processing de.duenndns.gmdice
  • Processing de.eidottermihi.raspicheck
  • Processing de.enaikoon.android.keypadmapper3
  • Processing de.feisar.wordvalue
  • Processing de.fgerbig.spacepeng
  • Processing de.fmaul.android.cmis
  • Processing de.fragdenstaat.app
  • Processing de.freewarepoint.whohasmystuff
  • Processing de.gabbo.forro_lyrics
  • Processing de.geeksfactory.opacclient
  • Processing de.grobox.blitzmail
  • Processing de.grobox.liberario
  • Processing de.guerda.matekarte
  • Processing de.hampager.dapnetmobile
  • Processing de.hechler.andfish
  • Processing de.hfu.funfpunktnull
  • Processing de.hirtenstrasse.michael.lnkshortener
  • Processing de.hoffmannsgimmicks
  • Processing de.hoffmannsgimmickstaupunkt
  • Processing de.homac.Mirrored
  • Processing de.hu_berlin.informatik.spws2014.mapever
  • Processing de.j4velin.pedometer
  • Processing de.j4velin.systemappmover
  • Processing de.j4velin.wifiAutoOff
  • Processing de.jdsoft.law
  • Processing de.jkliemann.parkendd
  • Processing de.joergjahnke.c64.android
  • Processing de.jurihock.voicesmith
  • Processing de.k3b.android.androFotoFinder
  • Processing de.k3b.android.calendar.ics.adapter
  • Processing de.k3b.android.contentproviderhelper
  • Processing de.k3b.android.intentintercept
  • Processing de.k3b.android.locationMapViewer
  • Processing de.k3b.android.toGoZip
  • Processing de.k4ever.k4android
  • Processing de.karbach.tac
  • Processing de.kodejak.hashr
  • Processing de.koelle.christian.trickytripper
  • Processing de.kromke.andreas.unpopmusicplayerfree
  • Processing de.kromonos.android.rpcoiner
  • Processing de.ktran.anno1404warenrechner
  • Processing de.kugihan.dictionaryformids.hmi_android
  • Processing de.langerhans.wallet
  • Processing de.larcado.sesam
  • Processing de.laxu.apps.nachtlagerdownloader
  • Processing de.leowandersleb.bitcoinsw
  • Processing de.lihotzki.pixelflood
  • Processing de.live.gdev.cherrymusic
  • Processing de.live.gdev.timetracker
  • Processing de.locked.cellmapper
  • Processing de.lsubel.amam
  • Processing de.luhmer.owncloudnewsreader
  • Processing de.mangelow.balance
  • Processing de.mangelow.debdroid
  • Processing de.mangelow.network
  • Processing de.mangelow.slideitloud
  • Processing de.mangelow.syncwifi
  • Processing de.mangelow.throughput
  • Processing de.markusfisch.android.shadereditor
  • Processing de.markusfisch.android.wavelines
  • Processing de.marmaro.krt.ffupdater
  • Processing de.mbutscher.wikiandpad.alphabeta
  • Processing de.measite.contactmerger
  • Processing de.meonwax.soundboard
  • Processing de.mpg.mpdl.labcam
  • Processing de.mreiter.countit
  • Processing de.msal.muzei.nationalgeographic
  • Processing de.naturalnet.mirwtfapp
  • Processing de.naturalnet.zahnarztgeraeusche
  • Processing de.nico.asura
  • Processing de.nico.gpt
  • Processing de.nico.ha_manager
  • Processing de.onyxbits.droidentify
  • Processing de.onyxbits.drudgery
  • Processing de.onyxbits.geobookmark
  • Processing de.onyxbits.listmyapps
  • Processing de.onyxbits.photobookmark
  • Processing de.onyxbits.pocketbandit
  • Processing de.onyxbits.remotekeyboard
  • Processing de.onyxbits.sensorreadout
  • Processing de.onyxbits.textfiction
  • Processing de.perflyst.batterycalibration
  • Processing de.ph1b.audiobook
  • Processing de.phoenixstudios.pc_dimmer
  • Processing de.pinyto.exalteddicer
  • Processing de.qspool.clementineremote
  • Processing de.quaddyservices.dynamicnightlight
  • Processing de.rampro.activitydiary
  • Processing de.reimardoeffinger.quickdic
  • Processing de.repat.mosf
  • Processing de.retujo.bierverkostung
  • Processing de.robv.android.xposed.installer
  • Processing de.saschahlusiak.freebloks
  • Processing de.schaeuffelhut.android.openvpn
  • Processing de.schildbach.wallet.faircoin
  • Processing de.schildbach.wallet
  • Processing de.schildbach.wallet_test
  • Processing de.serverfrog.pw.android
  • Processing de.shandschuh.slightbackup
  • Processing de.shandschuh.sparserss
  • Processing de.sigfood
  • Processing de.simplestatswidget
  • Processing de.skubware.opentraining
  • Processing de.smasi.tickmate
  • Processing de.srlabs.gsmmap
  • Processing de.srlabs.snoopsnitch
  • Processing de.stefan_oltmann.falling_blocks
  • Processing de.stefan_oltmann.kaesekaestchen
  • Processing de.steinpfeffer.rdt
  • Processing de.stephanlindauer.criticalmaps
  • Processing de.sudoq
  • Processing de.syss.MifareClassicTool
  • Processing de.szalkowski.activitylauncher
  • Processing de.t_dankworth.secscanqr
  • Processing de.tap.easy_xkcd
  • Processing de.tobiasbielefeld.brickgames
  • Processing de.tobiasbielefeld.solitaire
  • Processing de.tu_chemnitz.wlan
  • Processing de.tui.itlogger
  • Processing de.tum.in.tumcampus
  • Processing de.ub0r.android.callmeter
  • Processing de.ub0r.android.clipboardbeam
  • Processing de.ub0r.android.otpdroid
  • Processing de.ub0r.android.portaltimer
  • Processing de.ub0r.android.smsdroid
  • Processing de.ub0r.android.websms.connector.gmx
  • Processing de.ub0r.android.websms.connector.smspilotru
  • Processing de.ub0r.android.websms
  • Processing de.uni_potsdam.hpi.openmensa
  • Processing de.vanitasvitae.enigmandroid
  • Processing de.vibora.viborafeed
  • Processing de.we.acaldav
  • Processing de.westnordost.streetcomplete
  • Processing de.wikilab.android.friendica01
  • Processing de.xskat
  • Processing de.yaacc
  • Processing de.yazo_games.mensaguthaben
  • Processing de.zauberstuhl.sechat
  • Processing de.zieren.rot13
  • Processing dentex.youtube.downloader
  • Processing dev.drsoran.moloko
  • Processing dev.ukanth.ufirewall
  • Processing dk.andsen.asqlitemanager
  • Processing dk.jens.backup
  • Processing dk.kk.ibikecph
  • Processing dk.mide.fas.cmnightlies
  • Processing dk.nindroid.rss
  • Processing dmusiolik.pijaret
  • Processing douzifly.list
  • Processing dudeofx.eval
  • Processing dulleh.akhyou.fdroid
  • Processing edu.cmu.cs.speech.tts.flite
  • Processing edu.cmu.cylab.starslinger.demo
  • Processing edu.cmu.cylab.starslinger
  • Processing edu.cmu.pocketsphinx.demo
  • Processing edu.harvard.android.mmskeeper
  • Processing edu.killerud.kitchentimer
  • Processing edu.nyu.cs.omnidroid.app
  • Processing edu.rit.poe.atomix
  • Processing edu.sfsu.cs.orange.ocr
  • Processing ee.ioc.phon.android.speak
  • Processing ee.smkv.calc.loan
  • Processing email.schaal.ocreader
  • Processing errorc2146.whereaminext
  • Processing es.cesar.quitesleep
  • Processing es.esy.CosyDVR
  • Processing es.prodevelop.gvsig.mini
  • Processing es.usc.citius.servando.calendula
  • Processing et.nWifiManager
  • Processing eu.devunit.fb_client
  • Processing eu.domob.anacam
  • Processing eu.domob.angulo
  • Processing eu.domob.bjtrainer
  • Processing eu.domob.shopt
  • Processing eu.e43.impeller
  • Processing eu.faircode.finegeotag
  • Processing eu.faircode.netguard
  • Processing eu.faircode.xlua
  • Processing eu.flatworld.android.slider
  • Processing eu.hydrologis.geopaparazzi
  • Processing eu.inmite.android.gridwichterle
  • Processing eu.johncasson.meerkatchallenge
  • Processing eu.kanade.tachiyomi
  • Processing eu.lavarde.pmtd
  • Processing eu.lighthouselabs.obd.reader
  • Processing eu.mrogalski.saidit
  • Processing eu.polarclock
  • Processing eu.pretix.pretixdroid
  • Processing eu.prismsw.lampshade
  • Processing eu.siacs.conversations.legacy
  • Processing eu.siacs.conversations
  • Processing eu.siacs.conversations.voicerecorder
  • Processing eu.siebeck.sipswitch
  • Processing eu.uwot.fabio.altcoinprices
  • Processing eu.veldsoft.colors.overflow
  • Processing eu.veldsoft.complica4
  • Processing eu.veldsoft.fish.rings
  • Processing eu.veldsoft.four.row.solitaire
  • Processing eu.veldsoft.hungarian.rings
  • Processing eu.veldsoft.ithaka.board.game
  • Processing eu.veldsoft.politrics
  • Processing eu.veldsoft.scribe4
  • Processing eu.veldsoft.svarka.odds.calculator
  • Processing eu.veldsoft.tuty.fruty.slot
  • Processing eu.veldsoft.vitoshadm
  • Processing eu.vranckaert.worktime
  • Processing eu.wikijourney.wikijourney
  • Processing eu.woju.android.packages.hud
  • Processing faenza.adw.theme
  • Processing felixwiemuth.lincal
  • Processing fi.harism.wallpaper.flier
  • Processing fi.harism.wallpaper.flowers
  • Processing fi.harism.wallpaper.yinyang
  • Processing fi.mikuz.boarder
  • Processing fi.testbed2
  • Processing fil.libre.repwifiapp
  • Processing fly.speedmeter.grub
  • Processing fm.a2d.sf
  • Processing fm.libre.droid
  • Processing fr.asterope
  • Processing fr.bellev.stdatmosphere
  • Processing fr.free.nrw.commons
  • Processing fr.gaulupeau.apps.InThePoche
  • Processing fr.gaulupeau.apps.Poche
  • Processing fr.gouv.etalab.mastodon
  • Processing fr.herverenault.directdictaphone
  • Processing fr.herverenault.selfhostedgpstracker
  • Processing fr.hnit.babyname
  • Processing fr.hnit.riverferry
  • Processing fr.keuse.rightsalert
  • Processing fr.kwiatkowski.ApkTrack
  • Processing fr.librinfo.evecontrol2
  • Processing fr.ludo1520.whatexp
  • Processing fr.magistry.taigime
  • Processing fr.masciulli.drinks
  • Processing fr.miximum.napply
  • Processing fr.mobdev.blooddonation
  • Processing fr.mobdev.goblim
  • Processing fr.neamar.kiss
  • Processing fr.nicopico.dashclock.birthday
  • Processing fr.nocle.passegares
  • Processing fr.ornidroid
  • Processing fr.pssoftware.monescarcelle
  • Processing fr.pssoftware.scoretarot
  • Processing fr.renzo.wikipoff
  • Processing fr.s13d.photobackup
  • Processing fr.s3i.pointeuse
  • Processing fr.seeks
  • Processing fr.simon.marquis.preferencesmanager
  • Processing fr.simon.marquis.secretcodes
  • Processing fr.strasweb.asso
  • Processing fr.strasweb.browserquest
  • Processing fr.strasweb.campus
  • Processing fr.syncarnet
  • Processing fr.tvbarthel.apps.cameracolorpicker
  • Processing fr.tvbarthel.apps.simplethermometer
  • Processing fr.tvbarthel.apps.simpleweatherforcast
  • Processing fr.tvbarthel.attempt.googlyzooapp
  • Processing fr.ubordeaux.math.paridroid
  • Processing fr.unix_experience.owncloud_sms
  • Processing fr.xgouchet.packageexplorer
  • Processing fr.xgouchet.texteditor
  • Processing fr.xplod.focal
  • Processing fr.xtof54.dragonGoApp
  • Processing fr.xtof54.mousetodon
  • Processing fr.xtof54.scrabble
  • Processing fr.ybo.transportsbordeaux
  • Processing fr.ybo.transportsrennes
  • Processing free.rm.netcfgwidget
  • Processing free.rm.skytube.oss
  • Processing free.yhc.feeder
  • Processing free.yhc.netmbuddy
  • Processing ga.chschtsch.milonhapashut
  • Processing genius.mohammad.floating.stickies
  • Processing gg.mw.passera
  • Processing gingergan.com.tournament
  • Processing giraffine.dimmer
  • Processing git.rrgb.kinolog
  • Processing github.daneren2005.dsub
  • Processing github.yaa110.memento
  • Processing github.yaa110.piclice
  • Processing goo.TeaTimer
  • Processing gov.wa.wsdot.android.wsdot
  • Processing gq.nulldev.animeopenings.app
  • Processing gr.ndre.scuttloid
  • Processing gr.ratmole.android.Mach3Pendant
  • Processing gr.tsagi.jekyllforandroid
  • Processing grmpl.mk.stepandheightcounter
  • Processing groomiac.crocodilenote
  • Processing hashengineering.darkcoin.wallet
  • Processing headrevision.BehatReporter
  • Processing home.jmstudios.calc
  • Processing hr.kravarscan.enchantedfortress
  • Processing hsware.HSTempo
  • Processing hu.vsza.adsdroid
  • Processing i4nc4mp.myLock
  • Processing im.actor.cloud.free
  • Processing im.r_c.android.clearweather
  • Processing im.r_c.android.jigsaw
  • Processing im.tox.antox
  • Processing im.vector.alpha
  • Processing im.zom.messenger
  • Processing in.ac.dtu.subtlenews
  • Processing in.ac.iitb.cse.cartsbusboarding
  • Processing in.andres.kandroid
  • Processing in.blogspot.anselmbros.torchie
  • Processing in.indiandragon.shellshock.shellshockvulnerabilityscan
  • Processing in.p1x.tanks_of_freedom
  • Processing in.shick.diode
  • Processing in.shick.lockpatterngenerator
  • Processing in.shubhamchaudhary.logmein
  • Processing in.tosc.remotedroid
  • Processing in.umairkhan.remotedroid
  • Processing indrora.atomic
  • Processing info.aario.killcamera
  • Processing info.aario.snotepad
  • Processing info.dvkr.screenstream
  • Processing info.frangor.laicare
  • Processing info.guardianproject.browser
  • Processing info.guardianproject.cacert
  • Processing info.guardianproject.checkey
  • Processing info.guardianproject.courier
  • Processing info.guardianproject.gilga
  • Processing info.guardianproject.gpg
  • Processing info.guardianproject.lildebi
  • Processing info.guardianproject.locationprivacy
  • Processing info.guardianproject.notepadbot
  • Processing info.guardianproject.orfox
  • Processing info.guardianproject.otr.app.im
  • Processing info.guardianproject.pixelknot
  • Processing info.guardianproject.ripple
  • Processing info.kesavan.malartoon
  • Processing info.lamatricexiste.network
  • Processing info.meoblast001.thugaim
  • Processing info.metadude.android.congress.schedule
  • Processing info.papdt.blackblub
  • Processing info.schnatterer.nusic
  • Processing info.staticfree.SuperGenPass
  • Processing info.staticfree.android.robotfindskitten
  • Processing info.staticfree.android.twentyfourhour
  • Processing info.staticfree.android.units
  • Processing info.toyonos.hfr4droid
  • Processing info.zwanenburg.caffeinetile
  • Processing io.davidar.tensor
  • Processing io.github.alketii.mightyknight
  • Processing io.github.baiatbun.react
  • Processing io.github.benoitduffez.cupsprint
  • Processing io.github.droidapps.pdfreader
  • Processing io.github.engsergiu.react
  • Processing io.github.froodyapp
  • Processing io.github.fvasco.pinpoi
  • Processing io.github.fxthomas.sshbeam
  • Processing io.github.gsantner.memetastic
  • Processing io.github.hidroh.materialistic
  • Processing io.github.hopedia
  • Processing io.github.kobuge.games.minilens
  • Processing io.github.lonamiwebs.klooni
  • Processing io.github.lonamiwebs.stringlate
  • Processing io.github.mthli.Ninja
  • Processing io.github.otakuchiyan.dnsman
  • Processing io.github.phora.aeondroid
  • Processing io.github.phora.androptpb
  • Processing io.github.powerinside.scrollsocket
  • Processing io.github.powerinside.syncplay
  • Processing io.github.sanbeg.flashlight
  • Processing io.github.tjg1.nori
  • Processing io.github.tompreuss.apnsettings
  • Processing io.github.trytonvanmeer.libretrivia
  • Processing io.github.whirish.tvbuses
  • Processing io.githubfede0d.planetrider
  • Processing io.gitlab.mudassir.youtubecacher
  • Processing io.gresse.hugo.anecdote
  • Processing io.homeassistant.android
  • Processing io.mapsquare.osmcontributor
  • Processing io.mrarm.irc
  • Processing io.tiph.smsspammer
  • Processing io.trezor.app
  • Processing ir.hsn6.defendo
  • Processing ir.hsn6.k2
  • Processing ir.hsn6.trans
  • Processing ir.hsn6.turo
  • Processing is.pinterjann.jaws
  • Processing is.xyz.mpv
  • Processing isn.fly.speedmeter
  • Processing it.andreascarpino.forvodroid
  • Processing it.andreascarpino.hostisdown
  • Processing it.angrydroids.epub3reader
  • Processing it.devapp.android
  • Processing it.ecosw.dudo
  • Processing it.eternitywall.eternitywall
  • Processing it.fabmazz.triestebus
  • Processing it.faerb.crond
  • Processing it.feio.android.omninotes.foss
  • Processing it.gmariotti.android.apps.dashclock.extensions.battery
  • Processing it.greenaddress.cordova
  • Processing it.gtd.abreakout.GameActivity
  • Processing it.iiizio.epubator
  • Processing it.langolonerd.app
  • Processing it.linuxday.torino
  • Processing it.lucci.cm.greyscaletheme
  • Processing it.mn.salvi.linuxDayOSM
  • Processing it.mobimentum.dualsimwidget
  • Processing it.niedermann.owncloud.notes
  • Processing it.reyboz.bustorino
  • Processing it.reyboz.chordshift
  • Processing it.reyboz.minesweeper
  • Processing it.reyboz.screenlock
  • Processing it.rgp.nyagua.pafcalc
  • Processing it.rignanese.leo.slimfacebook
  • Processing it.rignanese.leo.slimtwitter
  • Processing it.sasabz.android.sasabus
  • Processing it.sieke.android.cacertorgcertificateinstaller
  • Processing it.sineo.android.noFrillsCPUClassic
  • Processing it.skarafaz.mercury
  • Processing italian.said.fran.theitaliansaid
  • Processing itkach.aard2
  • Processing ivl.android.moneybalance
  • Processing jackpal.androidterm
  • Processing jackpal.droidexaminer
  • Processing jonas.tool.saveForOffline
  • Processing jp.co.kayo.android.localplayer.ds.ampache
  • Processing jp.co.kayo.android.localplayer.ds.podcast
  • Processing jp.co.kayo.android.localplayer
  • Processing jp.co.omronsoft.openwnn
  • Processing jp.co.qsdn.android.jinbei3d
  • Processing jp.forkhub
  • Processing jp.gr.java_conf.hatalab.mnv
  • Processing jp.gr.java_conf.kumagusu
  • Processing jp.ksksue.app.terminal
  • Processing jp.redmine.redmineclient
  • Processing jp.sawada.np2android
  • Processing jp.sblo.pandora.aGrep
  • Processing jp.sfjp.webglmol.NDKmol
  • Processing jp.softstudio.DriversLicenseReader
  • Processing jp.takke.cpustats
  • Processing jp.takke.datastats
  • Processing jp.yhonda
  • Processing jpf.android.diary
  • Processing jpf.android.magiadni
  • Processing julianwi.javainstaller
  • Processing jupiter.broadcasting.live.tv
  • Processing jwtc.android.chess
  • Processing kaba.yucata.envoy
  • Processing kaljurand_at_gmail_dot_com.diktofon
  • Processing kdk.android.simplydo
  • Processing kellinwood.zipsigner2
  • Processing kiwi.root.an2linuxclient
  • Processing kmac.dejavu_fonts
  • Processing koeln.mop.elpeefpe
  • Processing kr.hybdms.sidepanel
  • Processing kr.softgear.multiping
  • Processing krasilnikov.alexey.cryptopass
  • Processing kvj.taskw
  • Processing lanchon.sigspoof.checker
  • Processing li.klass.fhem
  • Processing libretasks.app
  • Processing link.standen.michael.fatesheets
  • Processing link.standen.michael.phonesaver
  • Processing link.standen.michael.slideshow
  • Processing makeinfo.com.getid
  • Processing mancioboxblog.altervista.it.volumecontrol
  • Processing marto.rtl_tcp_andro
  • Processing mavonst.app.easylight
  • Processing max.music_cyclon
  • Processing mazechazer.android.wottankquiz
  • Processing mbmb5.lumixextendedcontrolapp
  • Processing me.alexghr.android.bulkshare
  • Processing me.alexghr.bulkshare.android.app2
  • Processing me.anuraag.grader
  • Processing me.anuraag.loveactualized
  • Processing me.bpear.archonpackager
  • Processing me.bpear.chromeapkpackager
  • Processing me.ccrama.redditslide
  • Processing me.danielbarnett.addresstogps
  • Processing me.dbarnett.acastus
  • Processing me.disconnect.mobile2
  • Processing me.echeung.cdflabs
  • Processing me.echeung.moemoekyun.fdroid
  • Processing me.guillaumin.android.osmtracker
  • Processing me.hda.urlhda
  • Processing me.jakelane.wrapperforfacebook
  • Processing me.jamesfrost.simpledo
  • Processing me.johnmh.boogdroid
  • Processing me.kuehle.carreport
  • Processing me.malladi.dashcricket
  • Processing me.murks.filmchecker
  • Processing me.phh.superuser
  • Processing me.sheimi.sgit
  • Processing me.shrimadhavuk.numselapp
  • Processing me.shrimadhavuk.watransmitter
  • Processing me.tripsit.tripmobile
  • Processing me.tsukanov.counter
  • Processing me.writeily.pro
  • Processing me.writeily
  • Processing me.zeeroooo.materialfb
  • Processing menion.android.whereyougo
  • Processing micropolis.android
  • Processing mixedbit.speechtrainer
  • Processing ml.adamsprogs.bimba
  • Processing mobi.boilr.boilr
  • Processing mobi.cyann.nstools
  • Processing mobi.omegacentauri.PerApp
  • Processing mobi.omegacentauri.SendReduced
  • Processing moe.feng.nhentai
  • Processing moe.martini.midictrl
  • Processing moe.minori.pgpclipper
  • Processing mohammad.adib.roundr
  • Processing monakhv.android.samlib
  • Processing naman14.timber
  • Processing name.bagi.levente.pedometer
  • Processing name.boyle.chris.sgtpuzzles
  • Processing name.juodumas.ext_kbd_lithuanian
  • Processing name.livitski.games.puzzle.android
  • Processing name.marfl.ext_kbd_bulgarian_phonetic
  • Processing name.myigel.fahrplan.eh17
  • Processing name.seguri.android.getforegroundactivity
  • Processing name.seguri.android.isphoneencrypted
  • Processing name.seguri.android.lock
  • Processing name.soulayrol.rhaa.sholi
  • Processing name.starnberger.guenther.android.cbw
  • Processing namlit.siteswapgenerator
  • Processing nerd.tuxmobil.fahrplan.camp
  • Processing nerd.tuxmobil.fahrplan.congress
  • Processing net.aangle.rvclock
  • Processing net.alaindonesia.silectric
  • Processing net.alegen.android.netclip
  • Processing net.altcoinfaucet.app
  • Processing net.androcom.dho.speakerproximity
  • Processing net.androgames.level
  • Processing net.androidcomics.acv
  • Processing net.anzix.osm.upload
  • Processing net.artificialworlds.rabbitescape
  • Processing net.asceai.meritous
  • Processing net.avs234
  • Processing net.bible.android.activity
  • Processing net.bierbaumer.otp_authenticator
  • Processing net.bitconomy.ckpoolwatcher
  • Processing net.bitplane.android.microphone
  • Processing net.bluetoothviewer
  • Processing net.bmaron.openfixmap
  • Processing net.bytten.xkcdviewer
  • Processing net.cactii.mathdoku
  • Processing net.chilon.matt.teacup
  • Processing net.codechunk.speedofsound
  • Processing net.commotionwireless.meshtether
  • Processing net.cyclestreets
  • Processing net.czlee.debatekeeper
  • Processing net.dahanne.android.regalandroid
  • Processing net.dahanne.banq.notifications
  • Processing net.damsy.soupeaucaillou.heriswap
  • Processing net.damsy.soupeaucaillou.recursiveRunner
  • Processing net.daverix.urlforward
  • Processing net.ddns.mlsoftlaberge.trycorder
  • Processing net.debian.debiandroid
  • Processing net.ebt.muzei.miyazaki
  • Processing net.etuldan.sparss.floss
  • Processing net.everythingandroid.smspopup
  • Processing net.exclaimindustries.geohashdroid
  • Processing net.fabiszewski.ulogger
  • Processing net.fercanet.LNM
  • Processing net.fred.feedex
  • Processing net.gaast.giggity
  • Processing net.georgewhiteside.android.abstractart
  • Processing net.glsk.wpgen
  • Processing net.gorry.aicia
  • Processing net.gorry.android.input.nicownng
  • Processing net.gsantner.markor
  • Processing net.haltcondition.anode
  • Processing net.healeys.lexic
  • Processing net.i2p.android.router
  • Processing net.i2p.android
  • Processing net.iexos.musicalarm
  • Processing net.imatruck.betterweather
  • Processing net.inbox.pager
  • Processing net.iowaline.dotdash
  • Processing net.jakevossen.apollotrivia
  • Processing net.jaqpot.netcounter
  • Processing net.jjc1138.android.scrobbler
  • Processing net.justdave.nwsweatheralertswidget
  • Processing net.kervala.comicsreader
  • Processing net.khertan.forrunners
  • Processing net.kismetwireless.android.smarterwifimanager
  • Processing net.kourlas.voipms_sms
  • Processing net.lardcave.keepassnfc
  • Processing net.loeuillet.wifi_eap_sim_conf
  • Processing net.logomancy.dashquotes.civ5
  • Processing net.logomancy.diedroid
  • Processing net.luniks.android.inetify
  • Processing net.mabako.steamgifts
  • Processing net.mafro.android.wakeonlan
  • Processing net.majorkernelpanic.spydroid
  • Processing net.mcarolan.whenzebus
  • Processing net.micode.compass
  • Processing net.micode.fileexplorer
  • Processing net.micode.soundrecorder
  • Processing net.minetest.minetest
  • Processing net.momodalo.app.vimtouch
  • Processing net.mypapit.mobile.myposition
  • Processing net.nightwhistler.pageturner
  • Processing net.nitroshare.android
  • Processing net.noio.Reminder
  • Processing net.nullsum.audinaut
  • Processing net.nurik.roman.dashclock
  • Processing net.nurik.roman.muzei
  • Processing net.olejon.mdapp
  • Processing net.olejon.spotcommander
  • Processing net.opendasharchive.openarchive.release
  • Processing net.oschina.app
  • Processing net.osmand.nauticalPlugin
  • Processing net.osmand.parkingPlugin
  • Processing net.osmand.plus
  • Processing net.osmand.srtmPlugin.paid
  • Processing net.pagekite.app
  • Processing net.pejici.easydice
  • Processing net.pejici.summation
  • Processing net.pherth.omnomagon
  • Processing net.phunehehe.foocam
  • Processing net.pierrox.mcompass
  • Processing net.pmarks.chromadoze
  • Processing net.programmierecke.radiodroid2
  • Processing net.progval.android.andquote
  • Processing net.ralphbroenink.muzei.unsplash
  • Processing net.rocboronat.android.wallpaper.npe
  • Processing net.rocrail.androc
  • Processing net.screenfreeze.deskcon
  • Processing net.sf.andbatdog.batterydog
  • Processing net.sf.andhsli.hotspotlogin
  • Processing net.sf.crypt.gort
  • Processing net.sf.ethersynth
  • Processing net.sf.times
  • Processing net.solutinno.websearch
  • Processing net.somethingdreadful.MAL
  • Processing net.sourceforge.andsys
  • Processing net.sourceforge.dibdib.android.dib2qm
  • Processing net.sourceforge.opencamera
  • Processing net.sourceforge.servestream
  • Processing net.sourceforge.solitaire_cg
  • Processing net.sourceforge.subsonic.androidapp
  • Processing net.sourceforge.wifiremoteplay
  • Processing net.status.client.mobile
  • Processing net.stkaddons.viewer
  • Processing net.sylvek.sharemyposition
  • Processing net.syncthing.lite
  • Processing net.syntaxblitz.plucklock
  • Processing net.szym.barnacle
  • Processing net.tapi.handynotes
  • Processing net.tedstein.AndroSS
  • Processing net.teknoraver.andhrystone
  • Processing net.tevp.postcode
  • Processing net.thauvin.erik.android.noussd
  • Processing net.tjado.passwdsafe
  • Processing net.usikkert.kouchat.android
  • Processing net.vivekiyer.GAL
  • Processing net.vreeken.quickmsg
  • Processing net.wigle.wigleandroid
  • Processing net.wireloss.android.fahrplan.pw16
  • Processing net.xenotropic.quizznworldcap
  • Processing net.yolosec.routerkeygen2
  • Processing net.yxejamir.misbotheringsms
  • Processing net.zygotelabs.locker
  • Processing nf.frex.android
  • Processing nightlock.peppercarrot
  • Processing nitezh.ministock
  • Processing nl.asymmetrics.droidshows
  • Processing nl.frankkie.bronylivewallpaper
  • Processing nl.implode.regenalarm
  • Processing nl.mpcjanssen.simpletask
  • Processing nl.sogeti.android.gpstracker
  • Processing nl.ttys0.simplec25k
  • Processing nl.yoerinijs.notebuddy
  • Processing no.rkkc.bysykkel
  • Processing nodom.darkfm.inventoryguimobile
  • Processing nodomain.freeyourgadget.gadgetbridge
  • Processing nu.firetech.android.pactrack
  • Processing nu.firetech.android.wifiwarning
  • Processing nya.miku.wishmaster
  • Processing nz.gen.geek_central.ObjViewer
  • Processing ohi.andre.consolelauncher
  • Processing ohm.quickdice
  • Processing openfoodfacts.github.scrachx.openbeauty
  • Processing openfoodfacts.github.scrachx.openfood
  • Processing orbitlivewallpaperfree.puzzleduck.com
  • Processing org.ab.x48
  • Processing org.abrantix.rockon.rockonnggl
  • Processing org.adaway
  • Processing org.adblockplus.android
  • Processing org.addhen.smssync
  • Processing org.adw.launcher
  • Processing org.afhdownloader
  • Processing org.aja.flightmode
  • Processing org.akvo.rsr.up
  • Processing org.ale.openwatch
  • Processing org.ale.scanner.zotero
  • Processing org.ametro
  • Processing org.aminb.mathtools.app
  • Processing org.amoradi.syncopoli
  • Processing org.andglkmod.hunkypunk
  • Processing org.androhid
  • Processing org.androidappdev.batterywidget
  • Processing org.androidappdev.wifiwidget
  • Processing org.androidfromfrankfurt.archnews
  • Processing org.androidpn.client
  • Processing org.androidsoft.app.permission
  • Processing org.androidsoft.coloring
  • Processing org.androidsoft.games.memory.kids
  • Processing org.androidsoft.games.memory.tux
  • Processing org.androidsoft.games.puzzle.kids
  • Processing org.androidsoft.games.slowit
  • Processing org.androidsoft.opendata.remarkabletrees
  • Processing org.andstatus.app
  • Processing org.anhonesteffort.flock
  • Processing org.anothermonitor
  • Processing org.appsroid.fxpro
  • Processing org.aprsdroid.app
  • Processing org.ardour
  • Processing org.asdtm.fas
  • Processing org.asdtm.goodweather
  • Processing org.asnelt.derandom
  • Processing org.asteroidos.sync
  • Processing org.atai.TessUI
  • Processing org.aykit.MyOwnNotes
  • Processing org.balau.fakedawn
  • Processing org.basketbuilddownloader
  • Processing org.bc_bd.mrwhite
  • Processing org.beide.bomber
  • Processing org.beide.droidgain
  • Processing org.berlin_vegan.bvapp
  • Processing org.bienvenidoainternet.app
  • Processing org.billthefarmer.accordion
  • Processing org.billthefarmer.crossword
  • Processing org.billthefarmer.currency
  • Processing org.billthefarmer.diary
  • Processing org.billthefarmer.editor
  • Processing org.billthefarmer.melodeon
  • Processing org.billthefarmer.scope
  • Processing org.billthefarmer.shorty
  • Processing org.billthefarmer.siggen
  • Processing org.billthefarmer.tuner
  • Processing org.birthdayadapter
  • Processing org.bitbatzen.wlanscanner
  • Processing org.bitbucket.tickytacky.mirrormirror
  • Processing org.blockinger.game
  • Processing org.blokada.alarm
  • Processing org.bobstuff.bobball
  • Processing org.bombusmod
  • Processing org.bottiger.podcast
  • Processing org.brandroid.openmanager
  • Processing org.briarproject.briar.android
  • Processing org.broeuschmeul.android.gps.bluetooth.provider
  • Processing org.c_base.c_beam
  • Processing org.chorem.android.saymytexts
  • Processing org.chrisbailey.todo
  • Processing org.ciasaboark.tacere
  • Processing org.cipherdyne.fwknop2
  • Processing org.cmotc.tools.rotationlockpp
  • Processing org.congresointeractivo.elegilegi
  • Processing org.connectbot
  • Processing org.coolfrood.mytronome
  • Processing org.coolreader
  • Processing org.cprados.wificellmanager
  • Processing org.creativecommons.thelist
  • Processing org.crocodile.sbautologin
  • Processing org.cry.otp
  • Processing org.csploit.android
  • Processing org.curiouscreature.android.shelves
  • Processing org.cyanogenmod.great.freedom
  • Processing org.cyanogenmod.oneclick
  • Processing org.cyanogenmod.wundergroundcmweatherprovider
  • Processing org.damazio.notifier
  • Processing org.daylightingsociety.wherearetheeyes
  • Processing org.de.jmg.learn
  • Processing org.debian.eugen.headingcalculator
  • Processing org.developfreedom.ccdroid.app
  • Processing org.developfreedom.logmein
  • Processing org.developfreedom.wordpowermadeeasy
  • Processing org.dgtale.icsimport
  • Processing org.disrupted.rumble
  • Processing org.diygenomics.pg
  • Processing org.dmfs.tasks
  • Processing org.dnaq.dialer2
  • Processing org.documentfoundation.libreoffice
  • Processing org.dolphinemu.dolphinemu
  • Processing org.domogik.domodroid13
  • Processing org.doubango.imsdroid
  • Processing org.dpadgett.timer
  • Processing org.droidparts.battery_widget
  • Processing org.droidseries
  • Processing org.droidupnp
  • Processing org.dsandler.apps.markers
  • Processing org.durka.hallmonitor
  • Processing org.dynalogin.android
  • Processing org.dyndns.fules.ck
  • Processing org.dyndns.ipignoli.petronius
  • Processing org.dyndns.sven_ola.debian_kit
  • Processing org.edunivers.whereami
  • Processing org.eehouse.android.xw4
  • Processing org.eff.actioncenter
  • Processing org.emergent.android.weave
  • Processing org.emunix.unipatcher
  • Processing org.envaya.sms
  • Processing org.epstudios.epmobile
  • Processing org.epstudios.morbidmeter
  • Processing org.equeim.tremotesf
  • Processing org.esteban.piano
  • Processing org.ethack.orwall
  • Processing org.eu.exodus_privacy.exodusprivacy
  • Processing org.evilsoft.pathfinder.reference
  • Processing org.example.pushupbuddy
  • Processing org.fairphone.launcher
  • Processing org.fastergps
  • Processing org.fdroid.fdroid.ota
  • Processing org.fdroid.fdroid.privileged.ota
  • Processing org.fdroid.fdroid.privileged
  • Processing org.fdroid.fdroid
  • Processing org.fdroid.superuser
  • Processing org.fedorahosted.freeotp
  • Processing org.fitchfamily.android.dejavu
  • Processing org.fitchfamily.android.gsmlocation
  • Processing org.fitchfamily.android.symphony
  • Processing org.fitchfamily.android.wifi_backend
  • Processing org.floens.chan
  • Processing org.flyve.inventory.agent
  • Processing org.fosdem
  • Processing org.fossasia.openevent
  • Processing org.fox.ttirc
  • Processing org.fox.ttrss
  • Processing org.fox.tttrss
  • Processing org.freedombox.freedombox
  • Processing org.freeminer.freeminer
  • Processing org.freshrss.easyrss
  • Processing org.froscon.schedule
  • Processing org.gateshipone.malp
  • Processing org.gateshipone.odyssey
  • Processing org.gc.networktester
  • Processing org.gege.caldavsyncadapter
  • Processing org.geometerplus.fbreader.plugin.local_opds_scanner
  • Processing org.geometerplus.fbreader.plugin.tts
  • Processing org.geometerplus.zlibrary.ui.android
  • Processing org.gfd.gsmlocation
  • Processing org.github.OxygenGuide
  • Processing org.gitorious.jamesjrh.isokeys
  • Processing org.gittner.osmbugs
  • Processing org.glucosio.android
  • Processing org.gmote.client.android
  • Processing org.gnu.icecat
  • Processing org.gnucash.android
  • Processing org.grapentin.apps.exceer
  • Processing org.gringene.colourclock
  • Processing org.gringene.concentricclock
  • Processing org.hanenoshino.onscripter
  • Processing org.happysanta.gd
  • Processing org.havenapp.main
  • Processing org.hekmatof.chesswatch
  • Processing org.helllabs.android.xmp
  • Processing org.hermit.audalyzer
  • Processing org.hermit.dazzle
  • Processing org.hermit.netscramble
  • Processing org.hermit.tricorder
  • Processing org.herrlado.ask.languagepack.czech
  • Processing org.herrlado.ask.languagepack.lithuanian
  • Processing org.herrlado.geofonts
  • Processing org.hiittimer.hiittimer
  • Processing org.hlwd.bible
  • Processing org.hoi_polloi.android.ringcode
  • Processing org.holylobster.nuntius
  • Processing org.horaapps.leafpic
  • Processing org.hwyl.sexytopo
  • Processing org.hystudio.android.dosbox
  • Processing org.icasdri.mather
  • Processing org.iilab.openmentoring
  • Processing org.iilab.pb
  • Processing org.indywidualni.fblite
  • Processing org.ironrabbit.bhoboard
  • Processing org.ironrabbit
  • Processing org.isoron.uhabits
  • Processing org.itishka.pointim
  • Processing org.jak_linux.dns66
  • Processing org.jamienicol.episodes
  • Processing org.janb.shoppinglist
  • Processing org.jessies.dalvikexplorer
  • Processing org.jessies.mathdroid
  • Processing org.jf.Penroser
  • Processing org.jfedor.frozenbubble
  • Processing org.jfedor.nxtremotecontrol
  • Processing org.jfet.batsHIIT
  • Processing org.jmoyer.NotificationPlus
  • Processing org.jsharkey.sky
  • Processing org.jsl.shmp
  • Processing org.jsl.wfwt
  • Processing org.jtb.alogcat
  • Processing org.jtb.droidlife
  • Processing org.jtb.httpmon
  • Processing org.kaqui
  • Processing org.katsarov.dofcalc
  • Processing org.katsarov.heatcalc
  • Processing org.kaziprst.android.ndfilter
  • Processing org.kde.kdeconnect_tp
  • Processing org.kde.ministro.config
  • Processing org.kde.necessitas.ministro
  • Processing org.kiwix.kiwixmobile
  • Processing org.kobuge.ninjatraining
  • Processing org.kontalk
  • Processing org.kore.kolabnotes.android
  • Processing org.kost.externalip
  • Processing org.kost.nmap.android.networkmapper
  • Processing org.kreed.vanilla
  • Processing org.kwaak3
  • Processing org.legtux.m_316k.fortune
  • Processing org.legtux.m_316k.taptheblacktiles
  • Processing org.lf_net.pgpunlocker
  • Processing org.liberty.android.fantastischmemo
  • Processing org.liberty.android.freeotpplus
  • Processing org.libreoffice.impressremote
  • Processing org.libresignal
  • Processing org.lichess.mobileapp
  • Processing org.ligi.ajsha
  • Processing org.ligi.blexplorer
  • Processing org.ligi.etheremote
  • Processing org.ligi.fahrplan
  • Processing org.ligi.fast
  • Processing org.ligi.gobandroid_hd
  • Processing org.ligi.ipfsdroid
  • Processing org.ligi.materialteatimer
  • Processing org.ligi.passandroid
  • Processing org.ligi.satoshiproof
  • Processing org.ligi.scr
  • Processing org.ligi.solar_activity_monitor
  • Processing org.ligi.survivalmanual
  • Processing org.ligi.vaporizercontrol
  • Processing org.linphone
  • Processing org.logicallycreative.movingpolygons
  • Processing org.lufebe16.pysolfc
  • Processing org.lumicall.android
  • Processing org.macno.puma
  • Processing org.madore.android.unicodeMap
  • Processing org.marcus905.wifi.ace
  • Processing org.mariotaku.imageviewergl
  • Processing org.mariotaku.twidere.extension.twitlonger
  • Processing org.mariotaku.twidere
  • Processing org.martus.android
  • Processing org.materialos.icons
  • Processing org.mbach.lemonde
  • Processing org.mcxa.vortaro
  • Processing org.mcxa.zephyrlogger
  • Processing org.me.tvhguide
  • Processing org.miamplayer.autoairplanemode
  • Processing org.michaelevans.nightmodeenabler
  • Processing org.microg.nlp.backend.apple
  • Processing org.microg.nlp.backend.ichnaea
  • Processing org.microg.nlp.backend.nominatim
  • Processing org.microg.nlp.backend.openwlanmap
  • Processing org.microg.nlp
  • Processing org.mixare
  • Processing org.mmk2410.cyngn.theme.fira
  • Processing org.moire.ultrasonic
  • Processing org.montrealtransit.android.schedule.stmbus
  • Processing org.montrealtransit.android
  • Processing org.moparisthebest.appbak
  • Processing org.moparisthebest.pageplus
  • Processing org.mosspaper
  • Processing org.mozilla.fennec_fdroid
  • Processing org.mozilla.firefox
  • Processing org.mozilla.klar
  • Processing org.mozilla.mozstumbler
  • Processing org.mrpdaemon.android.encdroid
  • Processing org.mult.daap
  • Processing org.mumod.android
  • Processing org.musicbrainz.picard.barcodescanner
  • Processing org.mustard.android
  • Processing org.mysociety.FixMyStreet
  • Processing org.mythdroid
  • Processing org.n52.sosmobileclient
  • Processing org.nathan.jf.build.prop.editor
  • Processing org.navitproject.navit
  • Processing org.ncrmnt.nettts
  • Processing org.ndeftools.boilerplate
  • Processing org.nerdcircus.android.klaxon
  • Processing org.nick.cryptfs.passwdmanager
  • Processing org.nick.wwwjdic
  • Processing org.ninthfloor.copperpdf
  • Processing org.notabug.lifeuser.moviedb
  • Processing org.npr.android.news
  • Processing org.ntpsync
  • Processing org.numixproject.iconsubmit
  • Processing org.nuntius35.wrongpinshutdown
  • Processing org.nutritionfacts.dailydozen
  • Processing org.nv95.openmanga
  • Processing org.ocsinventoryng.android.agent
  • Processing org.odk.collect.android
  • Processing org.ogre.browser
  • Processing org.okfn.pod
  • Processing org.olgsoft.apipepanic
  • Processing org.olpc_france.sugarizer
  • Processing org.openbmap
  • Processing org.openbmap.unifiedNlp
  • Processing org.opendroidphp
  • Processing org.openfoodfacts.scanner
  • Processing org.opengappsdownloader
  • Processing org.opengemara.shiurim
  • Processing org.opengpx
  • Processing org.openhab.habdroid.beta
  • Processing org.openhab.habdroid
  • Processing org.openintents.about
  • Processing org.openintents.filemanager
  • Processing org.openintents.flashlight
  • Processing org.openintents.notepad
  • Processing org.openintents.safe
  • Processing org.openintents.shopping
  • Processing org.openlp.android
  • Processing org.openlp.android2
  • Processing org.openmsx.android.openmsx
  • Processing org.openobservatory.ooniprobe
  • Processing org.openorienteering.mapper
  • Processing org.openpetfoodfacts.scanner
  • Processing org.opensatnav.android
  • Processing org.opentech
  • Processing org.openttd.sdl
  • Processing org.osmdroid
  • Processing org.osmocom.tacdatabaseclient
  • Processing org.pacien.tincapp
  • Processing org.paladyn.mediclog
  • Processing org.passwordmaker.android
  • Processing org.paulmach.textedit
  • Processing org.penghuang.tools.rotationlock
  • Processing org.peterbaldwin.client.android.tinyurl
  • Processing org.peterbaldwin.client.android.vlcremote
  • Processing org.petero.droidfish
  • Processing org.pipoypipagames.cows_revenge.id
  • Processing org.piwik.mobile
  • Processing org.piwik.mobile2
  • Processing org.pixmob.freemobile.netstat
  • Processing org.pocketworkstation.pckeyboard
  • Processing org.poirsouille.tinc_gui
  • Processing org.polaric.cyanogenmodchangelog
  • Processing org.poopeeland.tinytinyfeed
  • Processing org.ppsspp.ppsspp
  • Processing org.primftpd
  • Processing org.projectmaxs.main
  • Processing org.projectmaxs.module.alarmset
  • Processing org.projectmaxs.module.bluetooth
  • Processing org.projectmaxs.module.bluetoothadmin
  • Processing org.projectmaxs.module.clipboard
  • Processing org.projectmaxs.module.contactsread
  • Processing org.projectmaxs.module.fileread
  • Processing org.projectmaxs.module.filewrite
  • Processing org.projectmaxs.module.locationfine
  • Processing org.projectmaxs.module.misc
  • Processing org.projectmaxs.module.nfc
  • Processing org.projectmaxs.module.notification
  • Processing org.projectmaxs.module.phonestateread
  • Processing org.projectmaxs.module.ringermode
  • Processing org.projectmaxs.module.shell
  • Processing org.projectmaxs.module.smsnotify
  • Processing org.projectmaxs.module.smsread
  • Processing org.projectmaxs.module.smssend
  • Processing org.projectmaxs.module.smswrite
  • Processing org.projectmaxs.module.wifiaccess
  • Processing org.projectmaxs.module.wifichange
  • Processing org.projectmaxs.transport.xmpp
  • Processing org.projectvoodoo.audiomeasurementsplayer
  • Processing org.projectvoodoo.otarootkeeper
  • Processing org.projectvoodoo.screentestpatterns
  • Processing org.projectvoodoo.simplecarrieriqdetector
  • Processing org.proninyaroslav.libretorrent
  • Processing org.pulpdust.lesserpad
  • Processing org.pyload.android.client
  • Processing org.pyneo.maps
  • Processing org.qii.weiciyuan
  • Processing org.quantumbadger.redreader
  • Processing org.quovadit.apps.andof
  • Processing org.recentwidget
  • Processing org.redcross.openmapkit
  • Processing org.retroarch
  • Processing org.retroshare.android.qml_app
  • Processing org.rmll
  • Processing org.runnerup
  • Processing org.safermobile.intheclear
  • Processing org.sagemath.droid
  • Processing org.schabi.etherwake
  • Processing org.schabi.kiba
  • Processing org.schabi.newpipe
  • Processing org.schabi.nxbookmarks.owncloud
  • Processing org.schabi.nxbookmarks
  • Processing org.schabi.openhitboxstreams
  • Processing org.schabi.sharewithnewpipe
  • Processing org.schabi.svgredirect
  • Processing org.schabi.terminightor
  • Processing org.scid.android
  • Processing org.scoutant.blokish
  • Processing org.scoutant.cc
  • Processing org.scoutant.rpn
  • Processing org.scummvm.scummvm
  • Processing org.seamapdroid
  • Processing org.secuso.privacyfriendlyactivitytracker
  • Processing org.secuso.privacyfriendlycardgameone
  • Processing org.secuso.privacyfriendlydicer
  • Processing org.secuso.privacyfriendlymemory
  • Processing org.secuso.privacyfriendlynetmonitor
  • Processing org.secuso.privacyfriendlynotes
  • Processing org.secuso.privacyfriendlypaindiary
  • Processing org.secuso.privacyfriendlypasswordgenerator
  • Processing org.secuso.privacyfriendlypin
  • Processing org.secuso.privacyfriendlyruler
  • Processing org.secuso.privacyfriendlysudoku
  • Processing org.secuso.privacyfriendlytodolist
  • Processing org.secuso.privacyfriendlyweather
  • Processing org.secuso.privacyfriendlyyahtzeedicer
  • Processing org.segin.bfinterpreter
  • Processing org.segin.ttleditor
  • Processing org.sensors2.osc
  • Processing org.sensors2.pd
  • Processing org.servDroid.web
  • Processing org.servalproject.maps
  • Processing org.servalproject
  • Processing org.shadowice.flocke.andotp
  • Processing org.shirakumo.ocelot
  • Processing org.shortcuts
  • Processing org.sickstache
  • Processing org.sipdroid.sipua
  • Processing org.sixgun.ponyexpress
  • Processing org.smblott.intentradio
  • Processing org.smc.inputmethod.indic
  • Processing org.smerty.zooborns
  • Processing org.smssecure.smssecure
  • Processing org.softcatala.traductor
  • Processing org.softeg.slartus.forpdaplus
  • Processing org.sorz.lab.tinykeepass
  • Processing org.sparkleshare.android
  • Processing org.spechide.btappnder.whatsapptransmitter
  • Processing org.sshtunnel
  • Processing org.strawberryforum.pollywog
  • Processing org.subsurface
  • Processing org.sudowars
  • Processing org.sufficientlysecure.ical
  • Processing org.sufficientlysecure.keychain
  • Processing org.sufficientlysecure.localcalendar
  • Processing org.sufficientlysecure.standalonecalendar
  • Processing org.sufficientlysecure.termbot
  • Processing org.sufficientlysecure.viewer.fontpack
  • Processing org.sufficientlysecure.viewer
  • Processing org.sugr.gearshift
  • Processing org.supertuxkart.stk
  • Processing org.surrel.facebooknotifications
  • Processing org.surrel.messengerbypasser
  • Processing org.sw24softwares.starkeverben
  • Processing org.swiftp
  • Processing org.synergy
  • Processing org.systemcall.scores
  • Processing org.t2.synconwifi
  • Processing org.tamanegi.atmosphere
  • Processing org.tamanegi.wallpaper.multipicture.dnt
  • Processing org.tasks
  • Processing org.tbrk.mnemododo
  • Processing org.telegram.messenger
  • Processing org.thecongers.mtpms
  • Processing org.thialfihar.android.apg
  • Processing org.thosp.yourlocalweather
  • Processing org.thoughtcrime.securesms
  • Processing org.tigase.messenger.phone.pro
  • Processing org.tilelessmap.app
  • Processing org.tint.adblock
  • Processing org.tint
  • Processing org.tmurakam.presentationtimer
  • Processing org.tof
  • Processing org.tomdroid
  • Processing org.torproject.android
  • Processing org.totschnig.myexpenses
  • Processing org.totschnig.sendwithftp
  • Processing org.toulibre.capitoledulibre
  • Processing org.toulibre.cdl
  • Processing org.traccar.client
  • Processing org.transdroid.full
  • Processing org.transdroid.lite
  • Processing org.transdroid.search
  • Processing org.transdroid
  • Processing org.tryton.client
  • Processing org.ttrssreader
  • Processing org.tunesremote
  • Processing org.tuxpaint
  • Processing org.tvbrowser.tvbrowser
  • Processing org.tvheadend.tvhguide
  • Processing org.tw.onze.cmtheme
  • Processing org.twelf.cmtheme
  • Processing org.uaraven.e
  • Processing org.us.andriod
  • Processing org.valos.isolmoa
  • Processing org.vi_server.red_screen
  • Processing org.videolan.vlc
  • Processing org.voidptr.swpieview
  • Processing org.voidsink.anewjkuapp
  • Processing org.vono.narau
  • Processing org.vudroid
  • Processing org.wahtod.wififixer
  • Processing org.walleth
  • Processing org.webodf
  • Processing org.wheelmap.android.online
  • Processing org.whitequark.sipcaller
  • Processing org.wikilovesmonuments
  • Processing org.wikimedia.commons.muzei
  • Processing org.wikimedia.commons
  • Processing org.wikimedia.commons.wikimedia
  • Processing org.wikipedia
  • Processing org.wiktionary
  • Processing org.wingy.chan
  • Processing org.witness.informacam
  • Processing org.witness.sscphase1
  • Processing org.woltage.irssiconnectbot
  • Processing org.wordpress.android
  • Processing org.wroot.android.goldeneye
  • Processing org.xapek.andiodine
  • Processing org.xbmc.android.remote
  • Processing org.xbmc.kore
  • Processing org.xcsoar
  • Processing org.xphnx.ameixa
  • Processing org.xphnx.ameixamonochrome
  • Processing org.xphnx.iconsubmit
  • Processing org.xposeddownloader
  • Processing org.y20k.trackbook
  • Processing org.y20k.transistor
  • Processing org.yaaic
  • Processing org.yabause.android
  • Processing org.yaxim.androidclient
  • Processing org.yuttadhammo.BodhiTimer
  • Processing org.yuttadhammo.tipitaka
  • Processing org.zakky.memopad
  • Processing org.zamedev.gloomydungeons1hardcore.opensource
  • Processing org.zamedev.gloomydungeons2.opensource
  • Processing org.zeitgeist.movement
  • Processing org.zephyrsoft.checknetwork
  • Processing org.zephyrsoft.trackworktime
  • Processing org.zeroxlab.zeroxbenchmark
  • Processing org.zirco
  • Processing ovh.ice.icecons
  • Processing paulscode.android.mupen64plusae
  • Processing pc.javier.seguime
  • Processing pe.moe.nori
  • Processing peanutencryption.peanutencryption
  • Processing pep.android.k9
  • Processing pk.contender.earmouse
  • Processing pl.hypeapp.endoscope
  • Processing pl.hypeapp.episodie
  • Processing pl.librus.client
  • Processing pl.narfsoftware.thermometer
  • Processing pl.net.szafraniec.NFCKey
  • Processing pl.net.szafraniec.NFCTagmaker
  • Processing pl.nkg.geokrety
  • Processing pl.strimoid.lara
  • Processing player.efis.data.eur.rus
  • Processing player.efis.data.pan.arg
  • Processing player.efis.data.sah.jap
  • Processing player.efis.data
  • Processing player.efis.data.usa.can
  • Processing player.efis.data.zar.aus
  • Processing player.efis.mfd
  • Processing player.efis.pfd
  • Processing poly.darkdepths.strongbox
  • Processing priv.twoerner.brightnesswidget
  • Processing privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist
  • Processing pro.dbro.bart
  • Processing pro.dbro.openspritz
  • Processing pro.oneredpixel.l9droid
  • Processing pro.rudloff.openvegemap
  • Processing protect.babymonitor
  • Processing protect.babysleepsounds
  • Processing protect.budgetwatch
  • Processing protect.card_locker
  • Processing protect.gift_card_guard
  • Processing protect.rentalcalc
  • Processing protect.videoeditor
  • Processing pt.isec.tp.am
  • Processing pw.thedrhax.mosmetro
  • Processing raele.concurseiro
  • Processing re.jcg.playmusicexporter
  • Processing remuco.client.android
  • Processing rino.org.tethercompanion
  • Processing ro.ciubex.dscautorename
  • Processing ro.ieval.fonbot
  • Processing ro.mihai.tpt
  • Processing ro.ui.pttdroid
  • Processing ro.weednet.contactssync
  • Processing rs.pedjaapps.alogcatroot.app
  • Processing ru.equestriadev.mgke
  • Processing ru.exlmoto.snood21
  • Processing ru.gelin.android.browser.open
  • Processing ru.gelin.android.sendtosd
  • Processing ru.gelin.android.weather.notification.skin.biggertext
  • Processing ru.gelin.android.weather.notification.skin.blacktext
  • Processing ru.gelin.android.weather.notification.skin.blacktextplus
  • Processing ru.gelin.android.weather.notification.skin.whitetext
  • Processing ru.gelin.android.weather.notification.skin.whitetextplus
  • Processing ru.gelin.android.weather.notification
  • Processing ru.glesik.nostrangersms
  • Processing ru.glesik.wifireminders
  • Processing ru.henridellal.emerald
  • Processing ru.meefik.busybox
  • Processing ru.meefik.tzupdater
  • Processing ru.moscow.tuzlukov.sergey.weatherlog
  • Processing ru.neverdark.silentnight
  • Processing ru.o2genum.coregame
  • Processing ru.qrck.quitetaskmanager
  • Processing ru.ra66it.updaterforspotify
  • Processing ru.sash0k.bluetooth_terminal
  • Processing ru.subprogram.paranoidsmsblocker
  • Processing ru.ttyh.neko259.notey
  • Processing ru.valle.btc
  • Processing ru.zxalexis.ugaday
  • Processing ru0xdc.rtkgps
  • Processing ryey.camcov
  • Processing ryey.easer
  • Processing ryey.flock
  • Processing saschpe.contactevents
  • Processing saschpe.poker
  • Processing science.itaintrocket.pomfshare
  • Processing se.anyro.nfc_reader
  • Processing se.chalmers.doit
  • Processing se.danielj.geometridestroyer
  • Processing se.embargo.retroboy
  • Processing se.erikofsweden.findmyphone
  • Processing se.johanhil.clipboard
  • Processing se.johanhil.duckduckgo
  • Processing se.leap.bitmaskclient
  • Processing se.norenh.rkfread
  • Processing se.peterbjorkman.android.trafikinfo
  • Processing se.pp.mc.android.Gerberoid
  • Processing se.sandos.android.delayed
  • Processing se.traffar.dot_race
  • Processing se.tube42.drum.android
  • Processing se.tube42.kidsmem.android
  • Processing se.tube42.p9.android
  • Processing seanfoy.wherering
  • Processing sh.ftp.rocketninelabs.meditationassistant.opensource
  • Processing si.modrajagoda.didi
  • Processing siir.es.adbWireless
  • Processing simple.reboot.com
  • Processing sites.mjwhitta.scripter
  • Processing sk.baka.aedict
  • Processing sk.halmi.fbeditplus
  • Processing sk.madzik.android.logcatudp
  • Processing sk.vx.connectbot
  • Processing sonoroxadc.garethmurfin.co.uk
  • Processing sony.hidden.servicemenu
  • Processing souch.smp
  • Processing souch.smsbypass
  • Processing starcom.snd
  • Processing steele.gerry.dotty
  • Processing stericson.busybox.donate
  • Processing streetwalrus.usbmountr
  • Processing subreddit.android.appstore
  • Processing sun.bob.leela
  • Processing swati4star.createpdf
  • Processing systems.byteswap.aiproute
  • Processing szelok.app.twister
  • Processing teamunguided.brighttime
  • Processing teaonly.droideye
  • Processing telegra.ph
  • Processing teste.ndk
  • Processing tf.nox.wifisetup
  • Processing tk.al54.dev.badpixels
  • Processing tk.elevenk.dailybread
  • Processing tk.giesecke.phoenix
  • Processing tk.jordynsmediagroup.simpleirc.fdroid
  • Processing tk.radioactivemineral.metronome
  • Processing tkj.android.homecontrol.mythmote
  • Processing tmendes.com.analyticalbalancedroid
  • Processing to.doc.android.ipv6config
  • Processing to.networld.android.divedroid
  • Processing tof.cv.mpp
  • Processing tomer.com.alwaysonamoledplugin
  • Processing tranquvis.simplesmsremote
  • Processing trikita.obsqr
  • Processing trikita.slide
  • Processing trikita.talalarmo
  • Processing tritop.android.SLWTrafficMeterWidget
  • Processing tritop.android.androsens
  • Processing tritop.androidSLWCpuWidget
  • Processing tuioDroid.impl
  • Processing tum.betriebsysteme.kostadinov
  • Processing tv.piratemedia.lightcontroler
  • Processing tw.idv.palatis.danboorugallery
  • Processing tw.qtlin.mac.airunlocker
  • Processing uk.ac.cam.cl.dtg.android.barcodebox
  • Processing uk.ac.ed.inf.mandelbrotmaps
  • Processing uk.co.ashtonbrsc.android.intentintercept
  • Processing uk.co.bitethebullet.android.token
  • Processing uk.co.busydoingnothing.catverbs
  • Processing uk.co.busydoingnothing.prevo
  • Processing uk.co.danieljarvis.android.flashback
  • Processing uk.co.jarofgreen.JustADamnCompass
  • Processing uk.co.keepawayfromfire.screens
  • Processing uk.co.turtle-player
  • Processing uk.co.yahoo.p1rpp.calendartrigger
  • Processing uk.org.cardboardbox.wonderdroid
  • Processing uk.org.crimetalk
  • Processing uk.org.ngo.squeezer
  • Processing unisiegen.photographers.activity
  • Processing universe.constellation.orion.viewer
  • Processing uobikiemukot.yaft
  • Processing urbanstew.RehearsalAssistant
  • Processing us.achromaticmetaphor.agram
  • Processing us.achromaticmetaphor.imcktg
  • Processing us.bravender.android.dongsa
  • Processing us.feras.mdv.demo
  • Processing us.koller.cameraroll
  • Processing us.lindanrandy.cidrcalculator
  • Processing us.shandian.blacklight
  • Processing us.shandian.giga
  • Processing ut.ewh.audiometrytest
  • Processing vik.linx.stormify
  • Processing vnd.blueararat.kaleidoscope6
  • Processing vocabletrainer.heinecke.aron.vocabletrainer
  • Processing vu.de.urpool.quickdroid
  • Processing wb.receiptspro
  • Processing wiseguys.radar
  • Processing ws.xsoh.etar
  • Processing wsdfhjxc.taponium
  • Processing wseemann.media.romote
  • Processing x1125io.initdlight
  • Processing x653.bullseye
  • Processing yazilimcikoala.bytelauncher
  • Processing yellr.net.yellr_android
  • Processing youten.redo.ble.ibeacondetector
  • Processing z4pp3r.flashlightwidget
  • Processing za.co.lukestonehm.logicaldefence
  • Processing za.co.neilson.alarm
  • Processing zame.GloomyDungeons.opensource.game